KEGG   Pseudomonas aeruginosa RP73: M062_02250Help
Entry
M062_02250        CDS       T02711                                 

Definition
(GenBank) nuclease PIN
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
prp  Pseudomonas aeruginosa RP73
Brite
KEGG Orthology (KO) [BR:prp00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    M062_02250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AGO38399
Position
complement(498775..500397)
Genome map
AA seq 540 aa AA seqDB search
MTSDVLPADAVASAAGNAHKPHLEQRPGRLTALVFFAVLATGLLFSAYSLMQDVDDVGST
ITTWTPFLLLGVALLIALGFEFVNGFHDTANAVATVIYTHSLPPHFAVVWSGCFNFLGVL
LSSGAVAFGIIALLPVELILQVGSSAGFAMVFALLIAAILWNLGTWWLGLPASSSHTLIG
SIIGVGVANALMHGRDGTSGVDWGQATKVGYSLLLSPLIGFACAALLLLALRLLVKNRAL
YKAPKGKAPPPWWIRGLLILTCTGVSFAHGSNDGQKGMGLIMLILVGTLPMAYALNRTMP
ADQAVQFAAVAEVTQQALVKSAPQPAPADPRQVLSDYVRSKQASPELIPALAALTGSIGQ
EVKGYGAFSRVPAEAMGNVRNDMYLTSEAIRLMDKDGVGRFDADTRGKLQAFKQKIDDAT
KFIPLWVKIAVAIALGLGTMVGWKRIVVTVGEKIGKTHLTYAQGASAETVAMLTIGAADL
YGLPVSTTHVLSSGVAGTMAANGSGLQWKTIRNLLMAWVLTLPAAILLSASLYWLLTRLF
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgacctccgatgtccttcccgccgacgccgtcgccagtgccgccggcaacgcgcacaag
ccccatctcgagcagcgtcccggccgcctcaccgccctcgtattcttcgccgtgctcgcc
accggactgctgttcagcgcctacagcctgatgcaggacgtcgatgacgtcggttccacg
atcaccacctggacgcccttcctgctgctcggcgtggccctgctgatcgccctcggcttc
gagttcgtcaacggcttccacgacaccgccaacgcggtggccacggtgatctacacccac
tcgctgccgccgcacttcgcggtggtctggtcgggttgcttcaactttctcggcgtattg
ctctccagcggcgcggtggccttcggcatcatcgccctgctgccggtggaactgatcctg
caggtcggttcctcggccggcttcgccatggtcttcgccctgctgatcgccgccatcctg
tggaacctcgggacctggtggctgggcctgccggcgtcgtcctcgcacaccctgatcggc
tcgatcatcggcgtcggcgtggccaacgcgctgatgcatgggcgcgatggcaccagcggg
gtggactggggccaggcgaccaaggtcggctactccctgctgctctcgccgctgatcggc
ttcgcctgcgccgccctgttgctcctggcgctgcgcctgctggtgaagaaccgcgcgctg
tacaaggcgccgaagggcaaggcgccgccgccctggtggatccgcggcctgctgatcctg
acctgtaccggggtgtccttcgcccacggctccaacgacggacagaaaggcatgggcctg
atcatgctgatcctggtcggcaccctgccgatggcctacgccctgaaccgcaccatgccg
gcggaccaggcggtgcagttcgccgccgtcgccgaggtcacccagcaagcgctggtgaag
agtgcgccgcaaccggcgccggccgatccgcgccaggtactctccgactacgtgcgcagc
aagcaggcatcgcctgagctgatcccggcgctggccgccctgaccggctcgatcggccag
gaagtgaaaggctatggcgcgttctcgcgggtaccggcggaagccatgggcaacgtgcgc
aacgacatgtacctgacctccgaggcgatccgcctgatggacaaggacggcgtcggccgc
ttcgacgccgacacccgcggcaagttgcaggcgttcaagcagaagatcgacgacgccacc
aagttcatcccgctatgggtgaagatcgccgtggccatcgccctcggcctgggcaccatg
gtcggctggaaacgcatcgtggtgacggtcggcgagaagatcggcaagacccacctgacc
tacgcccagggcgcctcggcggaaaccgtggcgatgctgaccattggcgcggcggacctg
tatggcttgccggtatccaccacccatgtactgtcttccggggtggccgggaccatggcg
gcgaacggttcgggactacagtggaagaccatccgcaacctgctgatggcctgggtgctg
acgctgccggcggcgatcctgctctcggcctcgctctactggctgctcacccggctgttc
tga

DBGET integrated database retrieval system