KEGG   Pseudomonas aeruginosa RP73: M062_04075Help
Entry
M062_04075        CDS       T02711                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
prp  Pseudomonas aeruginosa RP73
Pathway
prp00480  Glutathione metabolism
prp00590  Arachidonic acid metabolism
prp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    M062_04075
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    M062_04075
Enzymes [BR:prp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     M062_04075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AGO38721
Position
876910..877392
Genome map
AA seq 160 aa AA seqDB search
MSAFHDLTLQGLDGQDLPLSPFKGKVLLVVNVASKCGLTPQYAGLENLYQTYRERGFAVL
GVPCNQFAGQEPGSEADIQSFCSLNYGVSFPMSAKVEVNGSARHPLYRLLAGEGAEFPGD
ITWNFEKFLLGPDGRVLARFSPRTAPDDPALVQAIEKALG
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcctttcacgatctcaccctgcaggggttggatggacaggacctgccgctttcc
ccgttcaagggcaaggtgctgctggtggtcaatgtcgcctccaaatgcggcctgacaccc
cagtacgccggcctggagaatctctaccagacctaccgcgagcgcggtttcgcggtgctc
ggcgtgccctgcaaccagttcgccggccaggagccgggcagcgaggcggatatccagtcc
ttctgtagcctgaactatggcgtcagcttcccgatgagcgccaaggtcgaggtcaacggc
agcgcgcggcatccgctctatcgcctgctggcgggcgagggcgcggagtttcccggcgac
atcacctggaacttcgagaaattcctcctcggtcccgacggtcgcgtgctggcgcgtttc
agcccgcgcacggcgccggacgacccggccctggtgcaagccatcgagaaggccctgggt
tga

DBGET integrated database retrieval system