KEGG   Pseudomonas aeruginosa RP73: M062_08835
Entry
M062_08835        CDS       T02711                                 

Definition
(GenBank) type VI secretion protein
  KO
K11896  type VI secretion system protein ImpG
Organism
prp  Pseudomonas aeruginosa RP73
Brite
KEGG Orthology (KO) [BR:prp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:prp02044]
    M062_08835
Secretion system [BR:prp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   M062_08835
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: AGO39460
Position
1867013..1868800
AA seq 595 aa
MSFNHYYQSELTALRQLGRRFAERSPALAPFLGQVGRDPDVERLLEGFAFLTGRLRQKLD
DELPELSHSMMHLLWPNYMRPLPAFSILQFDPLTRPGGALRVERDTPVESRPVGEVACRF
RTCYATEVLPLVLEALNYSVTGEGALLGLRLAMNCDGHLGELGLSRLRLHLAGERYISQM
LYLCLLRNLESIQLIPLDPHGRPLDGVAGKPMSFRLTGERVQPVGFAEDEALIPYPLNTF
RGYRYLQEYFAFQDKFLFVDVDGLDLLGALPEETLKQVRGLELRFDIRKSGIQRLHPTLE
NVKLYCTPVANLFRHDALPIRLDGKQDEYLLMPAEYSLEDCGVFSVEGVTGWRPGGLGYQ
AYVPFESFEHDPSFDVPEARPHYSVRQRTSLLHDGLDTYLSFGIRHPEQIETLSVELTCT
NQNLPQRLRLGDICVACEGTPEFLGFRNITPATPSYAPPLNRDFLWKLISNMSLNYLSLA
NVDALKVILETYDLPRYYDQHAAKVSKRLLGGLKSVRHEHVDRLHRGLPLRGLRTELTID
PEGYIGEGDLFVFASVLNEFFALYASINSYHELRVRSTQGDVYQWKPRMGLQPLL
NT seq 1788 nt   +upstreamnt  +downstreamnt
gtgtccttcaatcattactaccagagcgaactcaccgcactgcgccagctggggcgccgt
ttcgccgagcgtagcccggccctggccccgtttctcgggcaggtcggacgcgatccggat
gtcgagcgcctgctcgagggctttgccttcctgaccgggcggttgcggcagaagctggac
gacgagttgccggaactcagccactcgatgatgcacctgctgtggccgaactatatgcgc
ccgctgccggctttcagcattctccagttcgaccccctgacccgcccgggcggggcgctg
cgcgtggagcgcgatacgccggtcgagagccggccggtgggcgaggtcgcctgtcgcttc
cgtacctgctacgccaccgaagtcctgccgctggtgctggaggcgctcaactattcggtg
accggcgagggtgcgctgctcggcctgcgcctggcgatgaactgcgacgggcatctcggc
gagctgggcctgagtcggctgcgcctgcacctggccggcgagcgctacatcagccagatg
ctctacctgtgcctgctgcgcaacctggagagcatccaactgattccgctggacccccat
gggcggccgctggatggcgtggccggcaagccgatgtcgttccgcctgacgggcgagcgg
gtgcagccggtgggtttcgccgaagacgaggcgttgattccctatccgctgaataccttc
cgtggctatcgctacctgcaggagtacttcgcgttccaggacaagttcctgttcgtcgac
gtggatggccttgacctgctcggcgcgctgcccgaggaaaccctcaagcaggtccgcggc
ctcgagttgcgcttcgatatccgcaagagcggcatccagcgcctgcacccgacactggag
aacgtcaagctgtactgtacgccggtggccaacctgttccgccacgatgcgctgccgatc
cgcctcgacggcaagcaggacgagtacctgctgatgccggccgaatacagcctggaggac
tgcggggtgttctcggtagagggcgtcactggctggcggccgggtgggctcggctaccag
gcctatgtgccgttcgagtccttcgagcacgatcccagcttcgacgtcccggaagcacgg
ccccactacagcgtccggcaacggacctcgttgctgcacgatggcctggacacctacctg
agcttcggcatccgccatcccgagcagatcgagacgctgtcggtggaactgacctgcacc
aaccagaacctgccccaacggctgcgcctgggcgatatctgcgtcgcctgcgaaggcacg
ccggagttcctcggtttccgcaatatcaccccggcgacgccgagctacgcgccgccgctg
aaccgcgatttcctctggaaactgatcagcaacatgtcgctcaactacctgtcgctggcc
aacgtcgacgcgctcaaggtgatcctcgaaacctacgacctgccgcgctactacgaccag
catgcggcgaaggtcagcaagcgcctgctgggcgggctcaagtcggtccgccacgagcat
gtcgaccgcctgcatcggggcctgccgctgcgcggcttgcgtaccgagctgacgatcgat
ccggaaggctacatcggcgagggcgacctgttcgtgttcgcttcggttctgaacgaattt
ttcgcgctttacgccagcatcaactcctaccacgagttgcgggtgaggagcacacaggga
gacgtgtaccaatggaaaccgcgcatgggtttgcagcccctgctgtaa

DBGET integrated database retrieval system