KEGG   Pseudomonas aeruginosa RP73: M062_08875
Entry
M062_08875        CDS       T02711                                 

Definition
(GenBank) OmpA family protein
  KO
K11892  type VI secretion system protein ImpK
Organism
prp  Pseudomonas aeruginosa RP73
Pathway
prp03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:prp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    M062_08875
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:prp02044]
    M062_08875
Secretion system [BR:prp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   M062_08875
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: AGO39468
Position
1877216..1878085
AA seq 289 aa
MIKEREYHEDEKTVLLDHQGQVPAQGPLTDFAEPPRFEQLEERMIYAARLRPGEAFNVSL
NPLVAAASELLSEVVRLKHSTVLENLVALKERLTSAMKLFEFRAVQDGVENSQVMAARYV
LCTVVDEAVVTTPWGNESEWSKISLLSSFHNETFGGEKFFQLLDRLSKNPVKHLPMLELM
YLCLALGFEGKYRVMARGVLDLDGISDALYRQIRQLRGDVPRELSPHWQGLSDQRRGLVR
IVPWWMVALFTLVCLVVMYSGFAWVLGEQRDTVLQPYQSLDAAAGQPGS
NT seq 870 nt   +upstreamnt  +downstreamnt
atgatcaaggaaagggaataccacgaggacgagaagaccgtcctcctcgatcaccaggga
caggtaccggcccaggggccgctgaccgatttcgccgaaccgccgcgcttcgaacagctc
gaggagcggatgatctacgcggcgcgcctgcgtccgggcgaggccttcaacgtcagcctg
aacccgctggtggcggcggcttccgaactgctttcggaagtggtccggctcaagcacagc
accgtgctggagaaccttgtggcgctcaaggagcggttgacctccgccatgaagctcttc
gaattccgcgccgtgcaggatggcgtggaaaacagccaggtcatggcggcgcgctacgtg
ctgtgcacggtggtcgacgaggcggtggtgaccaccccgtggggcaacgaaagcgaatgg
tcgaagatcagcctgctgagcagcttccataacgagaccttcggcggcgagaagttcttc
cagttgctcgaccggctgtcgaagaacccggtcaagcacctgccgatgctggagctgatg
tacctctgcctggccctcggcttcgagggcaagtaccgggtgatggctcgcggcgtgctc
gacctggacggtatttccgatgcgctctaccggcagatccgccagttgcgcggcgacgtg
ccgcgcgaactgtcgccgcactggcaggggctcagcgaccagcgtcgcggcctggtgcgg
atcgtgccctggtggatggtggcgctgttcaccctggtctgcctggtggtgatgtattcg
ggattcgcctgggttctcggcgaacaacgcgacacggtgctgcagccttaccagtcgctc
gatgcggcggcaggacagcccggttcgtaa

DBGET integrated database retrieval system