KEGG   Pseudomonas aeruginosa RP73: M062_10430Help
Entry
M062_10430        CDS       T02711                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
prp  Pseudomonas aeruginosa RP73
Pathway
prp00071  Fatty acid degradation
prp00072  Synthesis and degradation of ketone bodies
prp00280  Valine, leucine and isoleucine degradation
prp00310  Lysine degradation
prp00362  Benzoate degradation
prp00380  Tryptophan metabolism
prp00620  Pyruvate metabolism
prp00630  Glyoxylate and dicarboxylate metabolism
prp00640  Propanoate metabolism
prp00650  Butanoate metabolism
prp00900  Terpenoid backbone biosynthesis
prp01100  Metabolic pathways
prp01110  Biosynthesis of secondary metabolites
prp01120  Microbial metabolism in diverse environments
prp01130  Biosynthesis of antibiotics
prp01200  Carbon metabolism
prp01212  Fatty acid metabolism
prp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:prp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    M062_10430
   00630 Glyoxylate and dicarboxylate metabolism
    M062_10430
   00640 Propanoate metabolism
    M062_10430
   00650 Butanoate metabolism
    M062_10430
  09103 Lipid metabolism
   00071 Fatty acid degradation
    M062_10430
   00072 Synthesis and degradation of ketone bodies
    M062_10430
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    M062_10430
   00310 Lysine degradation
    M062_10430
   00380 Tryptophan metabolism
    M062_10430
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    M062_10430
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    M062_10430
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    M062_10430
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:prp04147]
    M062_10430
Enzymes [BR:prp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     M062_10430
Exosome [BR:prp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M062_10430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DSBA
Motif
Other DBs
NCBI-ProteinID: AGO39733
Position
2215201..2216382
Genome map
AA seq 393 aa AA seqDB search
MQDVVIVAATRTAVGSFQGSLAGIPAPELGAAVIRRLLEQTGLDAGQVDEVILGQVLTAG
SGQNPARQAAIKAGLPVGVPAMTLNKVCGSGLKALHLGAQAIRCGDAEVIVAGGQENMSL
APYVMPGARTGLRMGHAKLVDSMIEDGLWDAFNDYHMGITAENLAEKYGLTREEQDAFAA
ASQQKAIAAIEGGRFRDEITPIQVPQRKGEPLSFDTDEQPRAGTTVEALAKLKPAFRKDG
SVTAGNASSLNDGAAAVLLMSAAKAKALGLPVLARIASYASAGVDPAIMGIGPVSATRRA
LDKAGWSLEQLDLIEANEAFAAQSLAVGRELGWDAARVNVNGGAIALGHPIGASGCRVLV
TLLYEMIRRDAKKGLATLCIGGGQGVALTLARD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacgtcgtcatcgtcgccgctacccgtaccgccgtcggcagcttccagggctcg
ctggccggcattcccgcccccgagctgggcgccgcggtaatccgccgcctgctcgaacag
accggtctcgatgccggccaggtcgacgaagtgatcctcggccaggtgctcaccgccggt
tccgggcagaacccggcgcgccaggcggcgatcaaggccggcctgccggtcggcgtgccg
gccatgaccctgaacaaggtctgcggctccggcctcaaggccctgcacctgggcgcccag
gcgatccgctgcggcgacgccgaggtgatcgtcgccggcggccaggagaacatgagcctg
gcgccctacgtcatgcccggcgcccgcaccggcctgcgcatgggccatgcgaagctggtc
gacagcatgatcgaggacggcctgtgggacgccttcaacgactaccacatgggcatcacc
gccgagaacctggcggagaagtacggcctgacccgcgaggagcaggacgccttcgccgcc
gcttcgcagcagaaggccatcgccgccatcgagggcgggcgcttccgcgacgagatcacg
ccgatccaggtcccgcagcgcaagggcgagccgctgagcttcgataccgacgagcagccg
cgcgccggcaccaccgtcgaggccctggccaagctcaagccggccttcaggaaggacggc
agcgtcaccgccggcaacgcctccagcctcaacgacggcgccgccgcggtattgctgatg
agcgcggccaaggccaaggccctgggcctgccggtgctggcgcggatcgccagctacgcc
agcgccggggtcgacccggcgatcatgggcatcggcccggtctccgccacccgtcgcgcg
ctcgacaaggccggctggagcctggagcaactggacctgatcgaggccaacgaggccttc
gccgcgcagtccctggcggtgggccgggaactgggctgggatgccgccagggtcaacgtc
aacggcggcgccatcgcccttggccacccgatcggcgcgtccggctgccgggtgctggtg
accctgctgtacgagatgatccgtcgcgacgcgaagaagggtctcgccaccctgtgcatc
ggcggcgggcagggcgtcgccctgaccctggcccgcgactga

DBGET integrated database retrieval system