KEGG   Pseudomonas aeruginosa RP73: M062_12310Help
Entry
M062_12310        CDS       T02711                                 

Definition
(GenBank) type VI secretion system protein ImpL
  KO
K11891  type VI secretion system protein ImpL
Organism
prp  Pseudomonas aeruginosa RP73
Pathway
prp02025  Biofilm formation - Pseudomonas aeruginosa
prp03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:prp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    M062_12310
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    M062_12310
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:prp02044]
    M062_12310
Secretion system [BR:prp02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   M062_12310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF_C HMG_box
Motif
Other DBs
NCBI-ProteinID: AGO40036
Position
complement(2651080..2654895)
Genome map
AA seq 1271 aa AA seqDB search
MSGATLFMLVLLLVLLALLLGALGWWWRTRGGTEIRSFYAAVRQMEREQGWQGRYEAPWL
LMLGNETEGEQLCSTWRLLPVARPAWFGRWWSDGEGAILLVPESVFLPDEGLRRQSGAWL
RLLRLFLRLRGRRALDGVVWNIPLARLQDGEQAANLGLAARRRFVELTQRLGLSLPVYVV
IAGLEDLPGFQELLAALPEEARERALGWSSPFAAEAAWQSRWCEQALEEITATLTESIVE
LGTLRGQVDNELYCLPPRLESLRGSLQALLEPVFQGNARGEAPRFRGLYLSGSEAAGAAA
DEVLPAVDAPRRRSSFASQLWARRILAEEGLAQAVPRILQLRQRWQRGIGLAALCLCLLW
GGLMTWVWRDALRDAGELSQLLHGASERYQPLDDDTRRAAQVRQNVQAWWQLVSQAPRWR
FTSLAFPSSWFSSLDARIDNAYRRVSERLLVRPLRSLLEGEASDLRAIRSDGQPGLKEGD
DPSQWKDYLAAKDLVARATTLERHNRLFAQAIDNRRTPLDDLLQLSNDALGSSYNGGSLA
RLAYYNRTLFAERPADLAALDLGRVAATAADNFHDLMARWLNAYFLTDSLERTGNALTQE
LAQLGQERDATAAQLLGIGELINHLQQQVNRINLIWGNGVGQDLVPGYQNLLKSAQQSSL
LGDRVEELQNLTVQLQQQFRSEWIAPPEAAGDGLLVKQGATLKLADDLLGLKRAIDDLKT
KDFVSVALADKTLADHSLLSIDDIGVTQALSFFNDFTGYYESTLPSLNPRYRYSVLHAAA
SAATEAMWQSLGPRSRSLASRNASRFDVQVKQVQVLQAALLELQDLQAGARLLLSLNALA
VADIGQALRDIDEQAVLREPVDFSRWSGAPNFGLQMFRAQDSAELKQSLNSQFNAMAAVA
ERHAPALEWLQAQQSSLATADYNAFVRFSALNAELQKFKADNPASTAAQLAKLVGNDFNQ
MDIGSCADILNGVLLPSSRSDLATRLVDLRQGALGRCQSLQQQQAAQAWKDLADYFNQYL
AGRFPFAYSLEAADAEPGRVRHLLKLMETRLPQVREGLAQVRSPDLPAAEDFVRRLEQAQ
RWLGPLFERDKSGLLGVALDIDWRSDRSLERGADQVIAWSLYSGDQESRFPGAQDKGLTW
NVGDPLKIMLRWAKNGSQRPADDPRQASLAVADLEAGWSYQGSWALLRMMRAHFSRQRPP
NVDYTEFPLVLQLPVYAPYSPENEARMFLRLSLMSLGGKTPLSIQPLPVRAPQSPFATLL
PATVASTGGTP
NT seq 3816 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgcgacgctgttcatgctggttctcctcctggtgctgctggcgctgctgctg
ggggcgctgggctggtggtggcgaacccgcggtggtacggagatccgcagcttctacgcg
gcggtccggcagatggagcgcgagcagggctggcagggccgctacgaagcgccgtggctg
ctgatgctcggcaacgagaccgagggcgagcagttgtgctccacctggcgtctgctgccg
gtggcgcgcccggcctggttcggccgctggtggtcggacggcgagggggcgatcctgctg
gtgcccgagtcggtgttcctgcccgacgagggcctgcgccggcaaagcggcgcctggctg
cgcctgttgcgtctgttcctgcgcctgcgtggcaggcgcgcgctggacggagtggtctgg
aacattccgctggcgcggctgcaggatggcgagcaggcggccaacctcggcctcgccgcg
cgccgtcgtttcgtggaactgacccagcgccttggcctgagcctgccggtttacgtggtg
atcgctggcttggaagacctgcctggcttccaggaacttctcgcggcgctgcccgaggag
gcgcgcgagcgcgccctcggctggtcctcgccgttcgccgccgaagcggcctggcagtcg
cgctggtgcgagcaggcgctggaggaaatcaccgccaccctgaccgagtcgatcgtcgaa
ctcggtaccttgcgcggccaggtggacaatgagctgtattgcctgccgccacgcctggaa
agcctccgcggttcgttgcaggcgctgctcgaaccggtcttccagggcaacgccaggggc
gaggcgccgcgctttcgcggtctctacctgagcggcagcgaggcggcgggcgcggcagcc
gacgaagtcctgccggcggtcgacgcgccgcgtcggcgcagcagcttcgccagccaactg
tgggcacggcggatccttgccgaggaaggcctggcccaggcggtgccgcgcatcctccag
ctgcgtcagcgctggcagcgcgggatcggcctcgccgcgttgtgcctgtgcctgctctgg
ggcggcctgatgacctgggtctggcgcgacgcgctgcgcgacgccggtgaactgtcgcaa
ctgctgcatggcgccagtgagcgctaccagccgctcgacgacgacacccggcgcgccgcc
caggtccggcagaacgtccaggcctggtggcaactggtgtcacaggcgccgcgctggcgc
ttcacttcgctggcgtttcccagttcctggttttcctccctggatgcacgtatcgacaac
gcgtatcgccgcgtttccgagcgcctgctggtgcgaccgctgcgcagcctgctggaaggc
gaggcgagcgacctgcgggcgatccgcagcgatggccaacccggcctgaaggagggcgac
gaccccagccagtggaaggactacctggcggcgaaggacctggtcgcccgcgccactacg
ctggagcgccacaatcgcttgttcgcccaggccatcgacaaccgcaggacgccgctcgac
gaccttctgcaactgagtaacgatgccctgggcagcagctacaacggcggcagcctggcg
cgcctggcctattacaaccgcacgctgttcgccgagcgtccggccgatctcgccgccctc
gatctgggccgggtcgccgccacggcggcggataacttccatgacctgatggcacgctgg
ctgaacgcctacttcctcaccgacagcctggaacgcaccggcaatgccctgacccaggaa
ctcgcgcagctcggccaggaacgagacgccacggcggcccagttgctggggatcggcgaa
ttgatcaaccacctgcagcaacaggtcaaccgcatcaacctgatctggggcaatggcgtc
ggccaggatctcgtccctggctaccagaacctgctcaagagcgcccagcaaagcagcctg
ctgggagaccgcgtggaggaactgcagaacctcaccgtgcagttgcagcagcagtttcgc
agcgaatggatcgcgcctccggaggctgccggtgacggcctgctggtgaaacagggggcg
acgctcaagctggccgatgacctgctcggtctgaaacgcgccatcgatgacctgaagacc
aaggacttcgtctccgtggccctggcggacaagacactggcggaccactccttgctgagc
atcgacgatatcggcgtgactcaggcgttgagcttcttcaacgacttcaccggctactac
gagagcaccctgccatcgctcaacccgcgctatcgctattcggtcctgcacgccgccgcc
agcgcggcgaccgaggccatgtggcaaagcctcgggccgcgcagtcgtagcctggccagt
cgcaatgcctcgcgtttcgacgtgcaggtcaagcaggtccaggtgttgcaggcggcgctg
ctggagttgcaggacctgcaggccggcgcgcgcctgctgctcagcctcaacgcgctggcc
gtggccgatatcggccaggccctgcgcgacatcgacgagcaggcggtgctgcgcgagccg
gtcgatttcagccgctggtcgggcgcgccgaatttcggcctgcagatgttccgcgcccag
gacagtgccgagctgaagcaaagcctgaacagccagttcaatgccatggcggccgtcgcc
gaacgccacgccccggcgctggagtggttgcaggcgcagcaatccagcctggccaccgcc
gactacaacgcgttcgtgcgcttcagcgcgctcaacgccgaactgcagaaattcaaggcc
gacaacccggcgagcaccgcggcgcagttggcgaagctggtgggtaacgatttcaaccag
atggacatcggcagttgcgccgacattctcaacggcgtgctcctgccgtccagccgcagc
gacctggcgacgcgcctggtggacctgcgccagggcgcgctcgggcgctgccagtcgttg
caacagcagcaggcggcgcaggcctggaaggacctcgccgactacttcaaccagtacctc
gccggacgcttcccgttcgcctacagcctggaagcggccgatgccgagccggggcgggtg
cggcacctgctgaaactgatggagacgcgcttgccgcaggtgcgcgaagggctggcccag
gttcgctcgccggacctgccggccgccgaggacttcgtccgccgcctggagcaggcgcag
cgctggctcggcccgctgttcgagcgcgacaagtcgggcctgctcggcgtcgccctggac
atcgactggcgcagcgaccgcagcctggaacgcggcgccgaccaggtgatcgcctggagc
ctgtactcgggcgaccaggaaagccgtttccccggcgcgcaggacaagggcctgacctgg
aatgtcggcgatccgctgaaaatcatgctgcgctgggcgaagaacggctcgcagcgtccg
gcagacgacccgcgccaggccagcctggcggtggccgacctcgaggccggctggagctac
cagggctcctgggcgctgttgcgcatgatgcgcgcgcacttctcccggcagcgcccgccg
aacgtcgactacacggagtttccgctggtcctgcaactgccggtgtatgcgccctacagc
ccggaaaacgaggcgcggatgttcctccgcctgtcgttgatgagcctgggcggcaagacc
ccgctgtccatccagccgctgccggtgcgcgcgccgcaatcgccgttcgcgacgctgttg
ccggccaccgtcgccagcaccggaggtaccccatga

DBGET integrated database retrieval system