KEGG   Pseudomonas aeruginosa RP73: M062_12865Help
Entry
M062_12865        CDS       T02711                                 

Definition
(GenBank) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
prp  Pseudomonas aeruginosa RP73
Pathway
prp00350  Tyrosine metabolism
prp00643  Styrene degradation
prp01100  Metabolic pathways
prp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:prp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    M062_12865
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    M062_12865
Enzymes [BR:prp01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     M062_12865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 DUF599
Motif
Other DBs
NCBI-ProteinID: AGO40121
Structure
PDB: 

Position
2816548..2817192
Genome map
AA seq 214 aa AA seqDB search
MQLYSFFNSSTSYRVRIALALKGLDYQVVPVNLRQGEQLRPADRQRNPMGALPTLVDADG
RRFSQSLAIIDYLDAVQPEPRLIPLDPLHRAQALELALLVACDIHPLNNVRVLKYLTQVL
GIDAEDRQRWYAHWVAEGLAAAETLLNRHRRGAFFAGAAAGIVECCLVPQLANARRMGCD
LAPYPALLELEGRCLALEAFQRVSPERQPDYLPD
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgcagctctacagcttcttcaacagctccacgtcctatcgggtgcgtatcgcattggcc
ctgaaaggcctggattaccaggtagtgccggtcaacctgcggcagggcgagcaactgcgc
ccggccgaccgccagcgcaacccgatgggcgcgctgccgaccctggtcgacgccgacggc
cgccggttcagccagtcgctggcgatcatcgactacctcgacgccgtgcagcccgaaccg
cgcctgatccctctcgacccactgcatcgcgcccaggcgctggaactggccctgctggtg
gcctgcgacatccatccgctgaacaacgtgcgggtgctcaagtatctgacccaggtcctc
ggcatagacgccgaggaccgccagcgctggtacgcgcactgggtcgccgagggcctggcg
gcggcggagaccctgctgaaccgacaccgtcgcggcgccttcttcgccggcgccgcagcg
ggcatcgtcgagtgctgcctggtaccgcaactggccaacgcccggcgcatgggctgtgac
ctggcgccctacccggcgttgctcgaactggaggggcgctgcctggcgctcgaagccttc
cagcgcgtcagccccgagcgccagcccgactacctgccggactga

DBGET integrated database retrieval system