KEGG   Pseudomonas aeruginosa RP73: M062_14770
Entry
M062_14770        CDS       T02711                                 

Definition
(GenBank) hypothetical protein
Organism
prp  Pseudomonas aeruginosa RP73
SSDB
Other DBs
NCBI-ProteinID: AGO40408
Position
complement(3202263..3202850)
AA seq 195 aa
MSQLPIPLPLNESRWRYVTASGGGMTVAFLAGSGGSITLLSPEGENVSFRYGGVGGGIGL
GMRLPRFGKVNLNVKGKSVGGAGALEALPSTGTVLVADGLVGRDLSRGDFTGPCMYVELG
AGVIAGGSGTAILFGLDPKLLAAVALASASPLTAALGASMSRQLLQSSRGALLMAGVNVG
AQFGGGAAAYLGALF
NT seq 588 nt   +upstreamnt  +downstreamnt
atgtcgcaacttcccattcccttgcccctcaacgagagtcgctggcgctacgtgacggcc
agtggcggaggcatgaccgtggccttcctggcgggtagcggcggctccatcacgttgctc
tcgccggagggtgagaacgtgtccttccgctatggcggggtgggcggcgggatcggactg
ggcatgcgcctgccgcgcttcggcaaggtcaacctcaatgtcaagggcaagagcgttggc
ggggccggtgcgctggaggcgttgccgagcaccggaaccgtcttggtcgcggacggcctg
gtggggcgcgacctgtcccgcggcgacttcaccgggccctgcatgtacgtcgaactcggc
gcgggagtcatcgccggcggttcgggcacggcgattctcttcggcctcgatcccaagctg
ctggcggcggtggcgctggcgagcgcctcgccattgaccgccgcgctgggcgccagcatg
tcgcggcaattactgcaatcgtcccgtggcgccctgttgatggccggggtcaacgtcggt
gcacagttcggcggcggcgcggcggcttacctgggggcgttgttctga

DBGET integrated database retrieval system