KEGG   Providencia sp. WCHPr000369: CYG50_06270Help
Entry
CYG50_06270       CDS       T05654                                 

Definition
(GenBank) long-chain-fatty-acid--CoA ligase FadD
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
prq  Providencia sp. WCHPr000369
Pathway
prq00061  Fatty acid biosynthesis
prq00071  Fatty acid degradation
prq01100  Metabolic pathways
prq01212  Fatty acid metabolism
prq02024  Quorum sensing
Module
prq_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:prq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CYG50_06270
   00071 Fatty acid degradation
    CYG50_06270
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CYG50_06270
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:prq01004]
    CYG50_06270
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:prq04147]
    CYG50_06270
Enzymes [BR:prq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     CYG50_06270
Lipid biosynthesis proteins [BR:prq01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   CYG50_06270
Exosome [BR:prq04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   CYG50_06270
  Exosomal proteins of breast cancer cells
   CYG50_06270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C AMP-binding_C_2 ATP-grasp_2
Motif
Other DBs
NCBI-ProteinID: AXH61658
UniProt: A0A345LU68
Position
complement(1019697..1021385)
Genome map
AA seq 562 aa AA seqDB search
MEKIWLKNYPADVPEEINPDSFASLAELLENAVSQFADQPAFINMGAVMTYRKLEERSRA
FAAYLQNGLGLKKGDRVALMMPNLLQYPIALFGILRAGMVVVNVNPLYTPRELEHQLNDS
GATAIVIVSNFAHTLEKIVFNTKVKHVILTRMGDQLSRPKATIVDFVVKYVKRLVPKYNL
PDAISFRRAMHYGYRMQYIKPNITGDDLAFLQYTGGTTGVAKGAMLTHRNMLANIEQARA
AYGPVLKFGAEFVVTALPLYHVFALTVNCLLFITVGGVNLLITNPRDVPDTVKQLGRYPI
TSITGVNTLFNAWLHNEEFKKLDFSRLRLSVGGGMPVQKAVAEKWQKLTGKHLLEGYGLT
ECAPLVTGNPYNLTSYSGSIGLPVPSTDVKFLDDEGNEVAIGEPGEMWVKGPQVMKGYWN
RPDSTADTIVDGWLATGDIAEIDSEGYIRIVDRKKDMIIVSGFNVYPNEIEDVISAHPDV
IECAAIGIPSESTGEAVKVFVVTKNANLTGDELKTFCRRSLTAYKVPKIFEFRDELPKSN
VGKILRKDLRDEEKLQREKSQV
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaaatctggctaaaaaattaccctgctgatgtgccggaagaaatcaatcctgat
agcttcgcttctctagcagagttacttgaaaatgcggtctctcaatttgccgaccaacct
gcattcattaacatgggcgcggtgatgacttatcggaaacttgaagagagaagccgcgct
tttgctgcctacttacaaaatggacttggccttaaaaaaggggatcgtgtcgcgttaatg
atgccaaacctattacaatatccgatagccttgtttgggatattacgtgcaggtatggtt
gtcgtaaacgttaacccactttataccccaagagaattagagcatcaattaaatgatagc
ggtgcaacagcaattgtcattgtgtcgaattttgcgcatacattggaaaaaattgttttc
aataccaaagtgaaacacgtcattttaactcggatgggtgaccagctttcacgccctaaa
gctacaattgttgattttgttgtcaaatatgtaaaacgcttagtccctaaatataattta
cccgatgcgatctcctttcgccgtgccatgcattatggctatcgtatgcaatatattaaa
cctaatattactggcgatgacttggcctttttgcaatatacgggtggaacgacgggggtt
gctaaaggagcgatgttaactcatcgcaacatgctagcaaacattgagcaggcaagggca
gcttacgggcctgtattgaaatttggcgctgaatttgttgtcactgcgttaccgctgtat
cacgtttttgcattgacagtaaactgcttactgtttatcactgtagggggcgttaactta
ttgattaccaaccctagagatgtgcccgataccgtaaaacaattaggacgttatcccatt
acatcaattacgggggttaataccttatttaatgcatggctgcacaatgaagagtttaaa
aaactggatttttcacgtttacgcctttcagttggcggtggcatgcctgttcaaaaagca
gttgcagaaaaatggcaaaagctcacaggaaaacatttactcgaaggatatggtttaaca
gaatgtgccccactagtaaccggtaatccttataatttaaccagttatagtggaagtatt
ggtttacctgttccgtcaacagatgttaaatttcttgatgatgaaggcaatgaagttgct
attggtgagccaggtgaaatgtgggtaaaaggtcctcaagtcatgaaaggctattggaac
cggcctgattccaccgctgatacgatagtggatggttggttagcaacgggggatatcgct
gaaatagatagcgaagggtatatccgcattgttgatcgtaaaaaagatatgattatcgtt
tcgggttttaacgtctatcctaatgaaatcgaggatgttatttctgcacatcctgatgtt
atagagtgtgctgcaattggcataccaagtgaaagtaccggcgaagcggttaaagttttc
gttgtaacgaaaaatgcgaatttaacgggtgatgagctaaaaaccttttgccgtcgttca
ttaaccgcgtataaagtccctaagatatttgaatttcgtgatgaattaccaaaatctaat
gtgggtaaaattctgcgtaaagacctacgtgatgaagaaaaattgcaaagagaaaaatca
caagtatga

DBGET integrated database retrieval system