KEGG   Providencia sp. WCHPr000369: CYG50_17020Help
Entry
CYG50_17020       CDS       T05654                                 

Definition
(GenBank) glycoside hydrolase family 3 protein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
prq  Providencia sp. WCHPr000369
Pathway
prq00520  Amino sugar and nucleotide sugar metabolism
prq01100  Metabolic pathways
prq01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:prq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CYG50_17020
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CYG50_17020
Enzymes [BR:prq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CYG50_17020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C PucR
Motif
Other DBs
NCBI-ProteinID: AXH64807
UniProt: A0A345M367
Position
complement(3316229..3318109)
Genome map
AA seq 626 aa AA seqDB search
MKKFTLLSACIFSAFSMANPITQAQLNELWQDKQKSAQEIVDNMSEAEKIGQLFMLDFRY
WNKDSNGEPAPFLAMNDEVSKVINQYHLGSVILFRENLIDTPQTVELINKLQSSRSNLPL
FIGTDQEGGYVTRLRVGTEMPGNMALGATRNPALAELTGMIHGYELSSLGFNINFGPVVD
VNNNQNNPVIGVRSYSDDKNLVGTLATSYIQGIHKYNLLTSLKHFPGHGNVSADSHVDLP
VVNSDAKTWRDTELVPFKYALSHGADAVMTAHIIVPALDDHKITTLAGKQVGTPATLSKP
ILHDILRDELNYDGLIVTDAMDMGAIADNFDINWAVETSLLAGSDIILMPIKMWDSQAVS
RLDNMYRYLETQAEKNPELKKRIDESAKRVVLKKLQQEITAQPVDIVKAEQVVASKGHKD
IENMVSEQAITLIKNENVLPYQLKPLNRIFTISDEKPRNSLIQKQLNDIAQETGVAIITG
ESVVKLNENTLTQDEAKKLVQNQDLVLLTTYNLKDTPTNAQLIIDAANQLKTPIVVISSR
NPYDIAYLNNVSANIAIYGITGFDITNNNRNSLETNIRSGLRTLFANTHGLPLNPPQGVL
PVNIKNPQGNKVLFPYGHGETYSTVN
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaattcactttacttagtgcttgtattttcagtgcgttttcaatggctaaccca
ataacacaagcccaattgaatgaattatggcaagacaaacaaaagtctgctcaagaaata
gtggataatatgtccgaggctgagaaaattggtcagctattcatgctggattttagatat
tggaataaagacagtaatggggaacccgcaccatttttggctatgaatgatgaggtttct
aaggttatcaatcaataccatctcggatcagtgatcctatttagagaaaatctgattgat
acaccacaaactgtggagttaattaataaacttcaatcttcccgcagtaaccttccatta
tttattggcaccgaccaagaaggcggctatgtcacccgcttacgcgtaggcaccgaaatg
cctggtaatatggctctaggcgcaacacgtaacccagcccttgcagagctaacagggatg
atccacggatatgagctatccagtcttggttttaatatcaattttggtccagttgttgat
gttaataacaatcaaaataacccagtgattggggtacgttcatactcagatgataaaaat
ttagttggaactctggccaccagctatattcaaggtattcataaatataatttattgacg
tcacttaaacatttccctggtcacggaaatgtttctgctgactctcatgttgatttaccc
gttgttaattctgacgcaaaaacatggcgagatactgaactcgtcccattcaaatacgcg
ttatctcatggtgctgatgccgtcatgaccgcacatattattgtaccagcactggatgac
cataagatcaccacacttgccggtaaacaagttggcaccccagcgacgctttccaaacct
attttgcatgatattttacgtgatgagctcaactatgacggcttgatagtgacagatgcc
atggatatgggggctattgcagacaatttcgatattaattgggcggtagaaacctcgcta
cttgctggctcagatattattcttatgccaatcaaaatgtgggactcccaagcggtttct
cgtttagataacatgtaccgctatttagaaacacaagcagaaaaaaatccagaactgaag
aaacgtattgatgaatccgcaaaacgtgtggtgctgaaaaagcttcagcaagaaattacg
gcacaacctgtagacatagtgaaagcggaacaagtcgtcgcatcaaaaggccataaagat
attgaaaatatggtttctgagcaggctatcacattaattaagaatgagaatgtactgcct
tatcaattaaaaccactcaatcgaattttcactatttctgatgaaaaaccacgtaattct
ttaattcaaaaacagttaaatgatatcgcacaagaaacgggagttgcgattattacaggt
gaaagtgtcgttaaattaaatgaaaacacactaactcaagatgaagcaaaaaaactggtg
caaaaccaagatttggtattactgacgacctataacttaaaggatacaccaacgaatgct
cagcttatcattgatgctgcaaaccaacttaaaaccccgattgttgttatctcttcacgt
aacccctatgacattgcatacctaaataatgtcagcgcaaatattgctatctacggtatc
actggatttgatatcaccaataataaccgcaattcattagaaaccaatattcgtagcggg
ttacggacattatttgctaacactcatggcctgccgctaaacccacctcaaggggtgcta
cccgttaatatcaaaaacccacaaggtaacaaagtcctgttcccttatggtcatggcgaa
acttactccacagtcaattaa

DBGET integrated database retrieval system