KEGG   Pseudoalteromonas rubra: AT705_01610Help
Entry
AT705_01610       CDS       T04179                                 

Definition
(GenBank) hypothetical protein
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
prr  Pseudoalteromonas rubra
Pathway
prr00360  Phenylalanine metabolism
prr00362  Benzoate degradation
prr00621  Dioxin degradation
prr00622  Xylene degradation
prr01100  Metabolic pathways
prr01120  Microbial metabolism in diverse environments
prr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:prr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    AT705_01610
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AT705_01610
   00622 Xylene degradation
    AT705_01610
   00621 Dioxin degradation
    AT705_01610
Enzymes [BR:prr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     AT705_01610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like
Motif
Other DBs
NCBI-ProteinID: ALU41734
UniProt: A0A0U3HVW2
Position
1:368370..369395
Genome map
AA seq 341 aa AA seqDB search
MAKITLLDCTLRDGGYHNNWDFSDKFVEQYLAVMSGCGVDIVELGYRDANPDNRRGRFAN
CSDEFLAGLPLPAGLTYAVMLDAKQVVSSTQALDEFMCRCIKPASESVVDLMRVAINYKE
VSKVSPLIRRLAAQGYRVALNLMQVTNGVLAELSHSLLELEELELVESVYFADSFGCMTP
LDIPKVVASIRKGWQGEIGFHGHDNKGLALLNALEATNTGITWIDSTVNGMGRGAGNVTT
ESLLNALYYERYKAHHGHMNQLIACHIEPLMEKYKWGTNLFYYIAAEKKIHPMYIQVLIA
NKHLDRMALLAVLDELAQHDASRFRADVLDMCLEASVAEPA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaataaccttgctagattgtaccctccgggatggggggtatcacaataattgg
gacttttctgacaaatttgttgagcaatatttggcggtgatgtctggttgtggtgtcgat
atcgtagagttaggttatcgcgatgcaaatcccgataaccgtcgtgggcggttcgctaac
tgttcggacgaattcttagcaggcttacctttgccggcaggtttgacttatgccgtgatg
ttagatgccaagcaggtcgtgtcgagtacgcaagcgctcgatgagttcatgtgtcgctgt
ataaagcctgcaagtgagtcagtggttgacttaatgcgagtggcgattaattacaaagag
gtcagtaaagtcagtccgttgatcagacgcctggctgcgcagggctaccgtgtagcgctc
aatttaatgcaagtgaccaatggcgttttagctgaactatcacacagccttctggaacta
gaagaactagagctggtcgagtcagtttactttgcagactcgtttggttgcatgactccg
ctggatattccaaaagtggtcgccagtatcagaaaaggatggcaaggagaaatcggtttt
catggtcatgacaacaagggactggctctgcttaacgcgcttgaagccacaaatacaggt
ataacctggatagattcgacggtaaatggcatggggcgcggcgctggtaatgtaacgact
gagtcgttgctcaatgctttatattatgagcgatataaagcgcatcatgggcatatgaac
caactgattgcatgtcacatagagccacttatggaaaagtacaaatggggcactaacctg
ttttattacattgcggcggagaaaaaaattcatcctatgtatatacaggtgctgatcgcg
aataagcacctggacaggatggctttattggctgtgctcgacgagttagcgcagcacgat
gcaagccgattccgggctgatgttttggatatgtgtctggaagcgagtgtagctgagcct
gcctaa

DBGET integrated database retrieval system