KEGG   Pseudoalteromonas rubra: AT705_04285Help
Entry
AT705_04285       CDS       T04179                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
prr  Pseudoalteromonas rubra
Pathway
prr00071  Fatty acid degradation
prr00072  Synthesis and degradation of ketone bodies
prr00280  Valine, leucine and isoleucine degradation
prr00310  Lysine degradation
prr00362  Benzoate degradation
prr00380  Tryptophan metabolism
prr00620  Pyruvate metabolism
prr00630  Glyoxylate and dicarboxylate metabolism
prr00640  Propanoate metabolism
prr00650  Butanoate metabolism
prr00900  Terpenoid backbone biosynthesis
prr01100  Metabolic pathways
prr01110  Biosynthesis of secondary metabolites
prr01120  Microbial metabolism in diverse environments
prr01130  Biosynthesis of antibiotics
prr01200  Carbon metabolism
prr01212  Fatty acid metabolism
prr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:prr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AT705_04285
   00630 Glyoxylate and dicarboxylate metabolism
    AT705_04285
   00640 Propanoate metabolism
    AT705_04285
   00650 Butanoate metabolism
    AT705_04285
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AT705_04285
   00072 Synthesis and degradation of ketone bodies
    AT705_04285
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AT705_04285
   00310 Lysine degradation
    AT705_04285
   00380 Tryptophan metabolism
    AT705_04285
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AT705_04285
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AT705_04285
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AT705_04285
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:prr04147]
    AT705_04285
Enzymes [BR:prr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AT705_04285
Exosome [BR:prr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AT705_04285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALU42225
UniProt: A0A0U2Z390
Position
1:complement(947577..948755)
Genome map
AA seq 392 aa AA seqDB search
MSNEAVVIVAAKRTPMGGFMGSLSGASATDLGATAIKAVMAETGLSDASIDEVIMGCVLP
AGLGQAPARQAMLHAGLARSTGATTINKVCGSGLKAAMFAHDLIKAGSINNAIAGGMESM
TNAPYFIPKARGGMRMGHGEIKDHMMADGLEDAYDNKAMGCFAQDTADEYGITRDNMDEF
ALSSLSKANAAIENGSFDNEVAAHVISTRKGDVEVAIDEQPGNARPDKIPSLRPAFKKDG
TITAANSSSISDGAAALVLMSESEAKRLGLTPLCKIAGHTTHSQAPAEFTVAPVGAMNKL
LEQTGWSKDDVDLWEINEAFAMVTMLAISELGLDQSKVNVNGGACALGHPIGASGARILV
TLIHALRNRGLSKGIASLCIGGGEAVALAVEV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacgaagctgttgtcattgtcgccgcaaaacgtacccctatgggtggatttatg
ggcagcctttcaggtgccagcgctactgatttaggtgcaaccgccattaaagcggtcatg
gctgagactggtttgtcagatgccagcattgatgaagtcattatgggttgtgtactgccg
gctggattaggccaggcacctgcacgtcaggctatgttacatgcgggtttagctcgttca
acaggcgcaaccacaattaataaagtatgtggatcaggtcttaaagcagccatgttcgcg
cacgatttaattaaagcaggtagcattaacaatgccatcgcaggtggtatggagagcatg
accaatgccccttactttatccctaaagcgcgtggtggtatgcgtatgggtcatggtgaa
atcaaagatcacatgatggcggatggcctcgaagatgcctacgacaataaagcaatgggt
tgcttcgcacaagatacggctgacgaatacggcattacgcgtgacaatatggatgagttt
gcgctgagctctttgagcaaagccaacgcagctatcgagaatggcagttttgacaatgaa
gttgcagcacatgtgatttcgactcgcaaaggtgatgttgaagtggccattgatgagcag
ccaggtaatgcacgtccggataagatcccatcactgcgcccggcgttcaaaaaagacggc
actatcaccgcagcaaattcttcttctatttcagacggtgcggcagcacttgtactgatg
agtgaatcagaagctaagcgtctcggtttaacaccgctgtgtaaaattgcaggtcacact
actcactctcaggcacctgctgagttcacagtcgcaccagtaggtgcaatgaataaactg
cttgaacaaactggctggtccaaagatgacgtggatctgtgggaaatcaacgaagcattt
gccatggtgactatgctggcgatcagcgagctaggccttgatcaaagtaaagtgaacgtg
aacggtggtgcctgtgcattgggccacccaatcggagccagcggtgcacgtatcttggta
acactcatccatgcgttacgcaatcgtggtttatcaaaagggattgcctcactgtgtatc
ggtggtggtgaagcggtggcattagccgtcgaagtttaa

DBGET integrated database retrieval system