KEGG   Pseudoalteromonas rubra: AT705_06580Help
Entry
AT705_06580       CDS       T04179                                 

Definition
(GenBank) acyl-CoA dehydrogenase
  KO
K21782  L-prolyl-PCP dehydrogenase [EC:1.3.8.14]
Organism
prr  Pseudoalteromonas rubra
Pathway
prr00333  Prodigiosin biosynthesis
prr01100  Metabolic pathways
prr01130  Biosynthesis of antibiotics
Module
prr_M00837  Prodigiosin biosynthesis, L-proline => prodigiosin
Brite
KEGG Orthology (KO) [BR:prr00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    AT705_06580
Enzymes [BR:prr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.14  L-prolyl-[peptidyl-carrier protein] dehydrogenase
     AT705_06580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_N Acyl-CoA_dh_2 PGM_PMM_III HpaB_N
Motif
Other DBs
NCBI-ProteinID: ALU42648
UniProt: A0A0U3HNW0
Position
1:1476945..1478099
Genome map
AA seq 384 aa AA seqDB search
MDFKLSDYQTELYDSALRFASEVLDKDAHQRQRNHHFAPELWQQAAQFGFTGLAVDEAYG
GADLGALNTMLMVEALGKGSRDLGLSFSLCAHLFACVMPLARFASDQLKRDFLEPLVAGK
LIAANAATEPGAGSDIYSMKTTAIKEAGGYRLNGQKTYITNAPVADVFVAYARTNPDHGF
MGVSAFIIPKDTPGLSTGASQSKDCLASCPMGDVFFDNVFVSESQRIGFEGAGGAIFHDS
MIWEKGCLFALFVGALDRLLESTLSYATERKQFGKKIGHFQSVSNRIIDIKLRLEQCRLM
LYRAGWKYDQGQDAEIDIAMSKLLISDYAVQSSLDAIATFGGAAIDADMGIVQVLLDTLP
SRIFSGTNDIQREIIARKLGLRGA
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggattttaagctttccgactatcaaaccgagttatacgattccgcgcttcgctttgct
tctgaggtgctcgacaaggatgcgcaccagcgtcagcgcaatcatcacttcgctcctgag
ctttggcagcaggcagctcaatttggcttcacaggcctggcagtagacgaagcctatggc
ggtgcagatctgggggcactcaacaccatgctaatggtagaggcactgggcaaaggcagc
cgcgatctcggcttgtcattctcgctgtgtgctcatctgtttgcctgcgtgatgcccctc
gcacgtttcgcaagtgaccaattaaagagggactttcttgaaccactggttgcgggaaaa
ttaattgcagccaatgcggctaccgagcctggtgcaggttcagatatctacagtatgaaa
acgaccgccatcaaagaagcgggtggttatcggctgaatggtcagaaaacctacatcacc
aatgcgcccgttgccgacgtattcgtggcctatgcacgaaccaatcccgaccacggcttt
atgggggtttccgctttcatcattcccaaagacacgccagggctatcaaccggtgccagc
caatccaaagactgtctcgccagctgcccgatgggtgacgtgttttttgacaatgtgttc
gtcagcgaatcacagcgcatcggctttgaaggggccggcggcgctatctttcatgactct
atgatctgggaaaaaggctgtctgtttgccctgtttgtcggtgctctggacaggttgctt
gagagcacactgagctatgccactgagcgcaaacaatttggtaaaaaaatcggtcatttt
cagtccgtatctaaccgtattattgacatcaaactgcgccttgagcagtgtcgcctgatg
ctctatcgcgccggctggaaatacgaccagggacaagatgctgagattgacattgctatg
agcaagctgttgatttcggactacgccgtccagtcttcactagatgccattgccactttt
ggtggcgctgcaatcgatgcagatatgggcattgtccaggtgctcctggatacgttgccc
agccgtattttctccggcaccaatgatattcaacgcgagatcatcgcccgaaaacttggc
ttaagaggagcctga

DBGET integrated database retrieval system