KEGG   Prosthecochloris sp. HL-130-GSB: B9H02_01050Help
Entry
B9H02_01050       CDS       T04847                                 

Definition
(GenBank) nucleotidyl transferase
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
prs  Prosthecochloris sp. HL-130-GSB
Pathway
prs00051  Fructose and mannose metabolism
prs00520  Amino sugar and nucleotide sugar metabolism
prs01100  Metabolic pathways
prs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:prs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    B9H02_01050
   00520 Amino sugar and nucleotide sugar metabolism
    B9H02_01050
Enzymes [BR:prs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     B9H02_01050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep DUF4954
Motif
Other DBs
NCBI-ProteinID: ARM30170
UniProt: A0A1W6HQB8
Position
complement(214146..215081)
Genome map
AA seq 311 aa AA seqDB search
MKAFVLAAGFGTRLRPLTHRIPKPLIPVLNLPALCYTLFLLKEAGIQDIICNVHYHASLI
RGFLDRNNHFGLSITISEEPEILGTGGGLKKCEPLLSGDDFLLINSDIIADFDLSAFISH
FRQSNAPGDLMLFSTPAARRIGHVGVSGGKILDFANRFKTGLESDYIYTGAALLRPEIFT
YLEHRFSSIVDTGFAGLMNHGGLAFFRHNGFWHDIGTPSGLWDLSIRHHDHITALADRMQ
KSIGRAPCMIAPGSEIHHGAKVVSSVVGNECIIERGARVERCILMPGTVIGKHETVTDSI
VCTEGRIDITS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcctttgtccttgcagcagggttcgggacccgcctcagaccgctgacacatcgg
atccccaagccactgatcccggtgctcaaccttcctgcattgtgctataccctttttctg
ctcaaggaagcgggaatacaggacattatctgcaatgtccactatcacgcatctctcatc
agaggatttctggatcgcaacaaccatttcgggctcagtatcaccatttccgaagagccc
gagatcctcgggacaggtggcgggctgaaaaagtgcgagcccctgctttccggcgacgat
tttctgcttatcaacagcgatatcatcgcagatttcgacctttctgcatttatcagccac
ttcaggcaatccaacgctccgggggacctgatgctgttcagcactccggcagcccgccgc
atcgggcatgtcggagtttcaggtggaaagatcctcgatttcgcaaaccgcttcaaaaca
ggcctcgaatcggattatatttacaccggggcagctcttctccgtcctgaaattttcacc
tatcttgaacataggttttcaagcattgtcgataccggatttgcgggcctgatgaatcat
ggaggcctggctttctttcggcacaatggtttctggcacgatatcgggaccccgtcggga
ctgtgggacctttcaatcaggcaccatgaccatatcacggcgcttgccgaccgtatgcag
aaaagcatcggcagagccccctgcatgatagcaccggggtcagaaatacatcacggggcg
aaggtggtctcgtcagtcgtgggaaatgagtgcataatagaacgtggcgcaagggtcgaa
cggtgcatactcatgccgggaacggtcatcggaaaacatgaaacagtcacagactcgatt
gtctgcacagaagggcgaattgacatcacctcctga

DBGET integrated database retrieval system