KEGG   Planococcus rifietoensis: AUC31_09615Help
Entry
AUC31_09615       CDS       T04201                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
prt  Planococcus rifietoensis
Pathway
prt03010  Ribosome
Brite
KEGG Orthology (KO) [BR:prt00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AUC31_09615
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:prt03011]
    AUC31_09615
Ribosome [BR:prt03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AUC31_09615
  Bacteria
    AUC31_09615
  Archaea
    AUC31_09615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ALS75455
UniProt: A0A0U2XF45
Position
3330590..3330931
Genome map
AA seq 113 aa AA seqDB search
MQAKAVARTVRIAPRKVRLVVDLIRGKQIGEAVAILNHTPKAASIVVEKLLKSAAANAEH
NYEMNIENLVISEVFVDEGPTLKRFRPRAMGRASAINKRTSHITLVVSEKKEG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcaaaagctgttgctagaacagtacgtattgctcctcgtaaagtccgtttagta
gtagatttaatccgaggcaagcaaatcggtgaagcggtcgcaattttgaaccatactcct
aaagcagcatccattgttgttgagaagttgttgaaatctgcagctgctaacgctgaacac
aattatgaaatgaacatcgagaaccttgtcatcagcgaagtattcgttgacgaagggccg
actttgaagcgtttccgtccacgtgcaatgggacgcgcgagcgcgatcaacaaacgcaca
agccacatcacactagtggtatctgagaagaaggagggataa

DBGET integrated database retrieval system