KEGG   Planococcus rifietoensis: AUC31_11255Help
Entry
AUC31_11255       CDS       T04201                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
prt  Planococcus rifietoensis
Pathway
prt00620  Pyruvate metabolism
prt00630  Glyoxylate and dicarboxylate metabolism
prt01100  Metabolic pathways
prt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:prt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AUC31_11255
   00630 Glyoxylate and dicarboxylate metabolism
    AUC31_11255
Enzymes [BR:prt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     AUC31_11255
    1.2.1.22  lactaldehyde dehydrogenase
     AUC31_11255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC Phage_ABA_S Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ALS77059
UniProt: A0A0U2XV99
Position
complement(2992898..2994322)
Genome map
AA seq 474 aa AA seqDB search
MYVNGEYIKSTGDEWIDIINPATEQVISKIPKGTEEDVNKAVEAAHQAQQAWELKPNIER
GKIVRKLGDKIAENRDKFIDLLQEEQGKDYELASGEVDLAIDYFHYMSEWARRIEGEIVP
SDHPNENILVYKKPIGVVAGIIPWNFPVFILARKVATALVTGCTIVIKPSQQTPNTAMEF
TKIVDAMEEIPKGVYNVVTGTGSEIGNALASHKKVQMITMTGSLPAGTKVMEAAAQNITK
VNLELGGKAPAIVTQHADLDLAAKAITTSRLANGGQACTNAERLYVHESVAEELSQKLIQ
AFEATKLGDPRESKDVTMGPLISQDRLETVEGMVKDAVSQGATVATGGERADLAGFFYKP
TILTNVTHDSDIMREEIFGPVLPMTTYSTIEEAIEMANDTVYGLSSSIYTDDLNEAMRVV
NEMKFGETYVNRENFEAVQGYHAGMRQSGLGGADGKHGMEDFLATQVVYMQYKK
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtatgtgaacggcgaatatataaagtctactggagacgaatggatcgacatcatcaac
ccggcaacggaacaagtgatttctaagattcctaaaggaacggaagaagatgtgaataag
gcagtagaagcggcgcatcaggcacaacaggcttgggaattgaaaccgaatatcgaacgc
gggaaaatcgtccgcaagctgggcgataaaatcgctgaaaaccgtgataaatttatcgac
ttattgcaggaagagcaaggaaaagactatgaactggcaagcggcgaagttgacttggcg
attgattacttccattatatgtccgaatgggcacgacgcatcgaaggggaaatcgtccca
agcgaccatccgaatgaaaatatcttagtctacaaaaagccgatcggcgtcgtagcaggc
attatcccttggaatttcccggtattcatcctggcacggaaagtcgcgacagcgcttgtc
actggctgcacaatcgtcatcaaaccgagccagcaaacaccgaataccgccatggaattc
acaaaaatcgtcgacgcgatggaagaaattccaaaaggcgtctacaatgtggtaaccgga
actggttctgaaatcggcaatgcgctggcttcgcacaagaaagttcagatgatcacgatg
acaggaagcttgccggccggtacgaaagtaatggaagcggcagcgcaaaacatcaccaag
gtcaatctcgaacttggcggtaaagcgccagctatcgtcacgcagcatgcagatttggac
ctggccgcaaaagccatcaccacatcgagactcgcaaatggcggacaggcgtgtacgaat
gcggagcgtctttatgtccatgaaagcgtggcggaagagctcagccaaaaacttatccag
gcattcgaagcgaccaagctcggcgacccgagagaaagcaaagacgtaacaatggggccg
ctgatcagccaggaccgtttggagactgtcgaaggcatggttaaagatgcagtgtcgcaa
ggggcgaccgttgcgacaggtggggaacgcgcggatctggccgggttcttctacaagcca
actattttaacgaacgtgacacacgattccgatatcatgcgtgaagagattttcggaccg
gtgcttccgatgaccacttacagcactattgaagaagcaattgaaatggccaacgatacg
gtttacggcttgtcttcttctatctatacagacgacctgaacgaagcaatgcgcgtcgtc
aatgaaatgaaattcggcgagacttacgtcaaccgtgaaaacttcgaagcagtgcagggc
tatcacgctggcatgcgccaatccggcctcggcggtgcggacggcaagcatggcatggaa
gacttccttgcgacacaagttgtttatatgcagtataaaaaataa

DBGET integrated database retrieval system