KEGG   Planococcus rifietoensis: AUC31_13980Help
Entry
AUC31_13980       CDS       T04201                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
prt  Planococcus rifietoensis
Pathway
prt00071  Fatty acid degradation
prt00072  Synthesis and degradation of ketone bodies
prt00280  Valine, leucine and isoleucine degradation
prt00310  Lysine degradation
prt00362  Benzoate degradation
prt00380  Tryptophan metabolism
prt00620  Pyruvate metabolism
prt00630  Glyoxylate and dicarboxylate metabolism
prt00640  Propanoate metabolism
prt00650  Butanoate metabolism
prt00900  Terpenoid backbone biosynthesis
prt01100  Metabolic pathways
prt01110  Biosynthesis of secondary metabolites
prt01120  Microbial metabolism in diverse environments
prt01130  Biosynthesis of antibiotics
prt01200  Carbon metabolism
prt01212  Fatty acid metabolism
prt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:prt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AUC31_13980
   00630 Glyoxylate and dicarboxylate metabolism
    AUC31_13980
   00640 Propanoate metabolism
    AUC31_13980
   00650 Butanoate metabolism
    AUC31_13980
  Lipid metabolism
   00071 Fatty acid degradation
    AUC31_13980
   00072 Synthesis and degradation of ketone bodies
    AUC31_13980
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AUC31_13980
   00310 Lysine degradation
    AUC31_13980
   00380 Tryptophan metabolism
    AUC31_13980
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AUC31_13980
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AUC31_13980
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AUC31_13980
Enzymes [BR:prt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AUC31_13980
Exosome [BR:prt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AUC31_13980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: ALS76233
UniProt: A0A0U2N6Q1
Position
complement(2453932..2455125)
Genome map
AA seq 397 aa AA seqDB search
MAKTVIIDGARTAFGKFGGSLSSFTASDLGAAAIKEALQRSQVNPEDVQEVIMGNVLQAG
QGQIPSRQAAKKAGIPYHVKSETINKVCASGLRSVTLADQIIRLGDEELIVAGGMESMSN
APYYLPKARFGLRMGDSQVVDGMVHDGLSCSFHPDKVHMGTYGNSTAETFELTRERQDEW
AARSHERAIKARDHFSEEITAMEVPQRKGDPITVDQDEAPREGTTSEVLAKLRPAFGKDG
TITAGNAPGINDGAAALVLMSEERAQKDGKSVLAHVVGHTEVAVEPHRFPETPGLVINEL
LKKTGKTLEEIDLFEINEAFAAVALASSKIAGLDEEKVNVNGGSVALGHPIGASGARIIL
TLAYELKRRGGGIGIAAICSGGGQGDAVMIEVPKEEN
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaacggtcatcattgatggagcacgcacagcattcggaaaatttggcgggtca
ctcagttcattcacggcaagcgacctcggagcagcagcgatcaaggaagcgctccaacgt
tcgcaagtaaatcctgaagatgtgcaggaagtcatcatgggcaatgtcttgcaggcagga
caagggcaaatcccatcccgtcaggcagctaaaaaagctggcattccttaccacgtgaaa
tctgaaacgatcaataaagtatgtgcatccggtttgcgctctgtcacgttagcagaccaa
atcatccgcttaggagacgaagaattgatcgtcgcaggcggcatggaatcgatgtcgaac
gcgccttactatttgccaaaagcacgcttcggccttcgaatgggcgattcacaagtcgta
gatggcatggtccatgacggcttgtcgtgttccttccacccggacaaagtgcatatgggc
acatatggcaactcgacggcagaaaccttcgaactgacacgtgaaagacaagacgaatgg
gcagcacgttcccacgaacgagcaattaaagcgcgcgatcatttttcagaagaaattacg
gcgatggaagtgcctcagcgtaaaggcgatccaattactgtcgatcaggatgaagcgccg
cgtgaaggcacaacatctgaagtgctggcgaaactgcgcccggcattcggcaaagatggc
acgattaccgccggcaacgcacccggaatcaatgatggagcagcagcactcgtattgatg
agtgaagaacgcgcacaaaaagacgggaaatccgtattagctcatgtcgtagggcataca
gaagtcgcggtcgaaccgcatcgtttcccggaaacaccggggctcgtcatcaatgaatta
ctcaaaaaaactggcaaaacattagaagaaatcgatctgtttgaaatcaacgaagcattc
gctgcagtggcgctggcgagttcgaaaattgctggccttgacgaagaaaaagtcaacgtc
aacggcggatctgtcgcactcggccatccgatcggtgcaagcggggcgcgcatcatcttg
acgctcgcttatgaattgaaacgccgcggaggcggcatcggaatcgccgcaatctgctcg
ggcggcggacaaggcgatgctgtaatgatcgaagtaccgaaggaggaaaactaa

DBGET integrated database retrieval system