KEGG   Planococcus rifietoensis: AUC31_15185Help
Entry
AUC31_15185       CDS       T04201                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
prt  Planococcus rifietoensis
Pathway
prt00051  Fructose and mannose metabolism
prt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AUC31_15185
Enzymes [BR:prt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     AUC31_15185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ALS76462
UniProt: A0A0U2YY29
Position
complement(2198151..2199356)
Genome map
AA seq 401 aa AA seqDB search
MKQAIHFGAGNIGRGFIGALFSESGYHVSFVDVAEQVIDGLNAQGQYRVNMAQETEESVL
VENVSGINNMKDEEAVIAKIQQATYLTTAIGPNILPRIAPLIAKGIEARVKGNFATGPDL
VPASDLDVATDMSAGSEKLYIIACENQIGATDILKGHILSHLSDEAKADLAGKVYFFNSA
VDRIVPIQEGHSLDVLVEPYYEWVVETTEDIPHVTGMTIVEDLAPFIERKLFTVNTGHAV
IAYYGYLAGKTTIDETLADPEIEQEVRETLKETGAYLVKQYGLDEDEHLDYIDKNIERFK
NSYLNDGVTRVGRAPIRKLGPEDRLVRPAVQAQKAGLAYSHLAKAIAAALLFDYAEDEEA
VKIQEMIAQGGPERVLTEVSGLEADSELAKEVVRQYEAMKK
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagcgattcattttggagcaggcaatatcggcagagggtttatcggggcgttg
ttctcggaatccggctatcacgtcagtttcgtcgatgtggcggaacaagttatcgacggg
ttgaacgcacaaggccagtaccgcgtcaacatggcgcaggagacagaagaaagcgtcttg
gtggagaatgtatcgggcatcaataatatgaaagacgaagaagcggtcattgcgaagatc
cagcaagcgacgtatttgacgacggcaatcgggccgaacattttgccgcgcattgcgccg
ttaatcgcaaaaggaatcgaagcgcgcgtcaaaggcaatttcgcgacggggccggatttg
gtgccggcgtctgatttggatgtagcgacagacatgagcgcgggttcggaaaaattatac
atcattgcctgtgaaaaccagatcggcgcgaccgatattttgaaaggacatattttgagc
catttgagcgacgaagcgaaagcggatctcgccggcaaagtgtatttctttaattcggcg
gtcgaccgcattgtgccgatccaggaaggccattcgcttgatgtcttggttgagccgtat
tacgagtgggttgttgaaacgactgaagacattcctcacgtgaccggcatgacgattgtc
gaagacttggcgccgttcattgagcgcaagctgttcacagtcaatacggggcacgcggtc
atcgcgtattacggctatctcgccggcaaaacgacaatcgatgaaaccttggccgacccg
gaaattgaacaagaagtgcgggaaaccttaaaagagacgggcgcgtacctcgtgaagcaa
tacggcttggacgaagacgagcaccttgactatatcgataaaaacatcgaacgcttcaaa
aacagctatttgaacgacggcgtcacgcgcgtcggccgcgcgccgatccgcaagctcggc
ccggaagaccgcctcgtgcgcccggccgtgcaagcgcaaaaagcggggcttgcgtattcg
catctcgcgaaagcgatcgcggcggcgttgttgttcgattatgcagaagacgaagaagcg
gtaaaaatccaagagatgatcgcacaaggcgggccggagcgcgtattgacagaagtcagc
gggcttgaagctgacagcgaactggcgaaagaagtcgtgcgccagtatgaggcgatgaag
aagtag

DBGET integrated database retrieval system