KEGG   Prevotella ruminicola: PRU_0085Help
Entry
PRU_0085          CDS       T01212                                 

Gene name
rfbC_1
Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
pru  Prevotella ruminicola
Pathway
pru00521  Streptomycin biosynthesis
pru00523  Polyketide sugar unit biosynthesis
pru01130  Biosynthesis of antibiotics
Module
pru_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:pru00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    PRU_0085 (rfbC_1)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PRU_0085 (rfbC_1)
Enzymes [BR:pru01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     PRU_0085 (rfbC_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ADE82766
UniProt: D5EVF3
Position
109366..109920
Genome map
AA seq 184 aa AA seqDB search
MEVRKTSIDGVFIIEPRIFEDSRGYFFESFSQREFEEKIGPINFVQDNESKSSYGVMRGL
HFQRPPFTQSKLVRCVKGAVLDVAVDIRKGSPTYGQHVAVELTEDNHRQFFIPKGFAHGF
AVLSETAVFQYKCDEFYHPEADGGISILDESLNIDWHIPTDKAILSDKDTKHPLLKDFET
PFNY
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggaagttagaaaaacatcaattgatggtgtgttcattatcgaaccccgaattttcgag
gatagccgtggctatttctttgaatctttctctcaacgagagttcgaagaaaaaatcggc
ccaatcaatttcgttcaggacaacgagtccaaatcaagctatggcgtaatgcgtggcttg
cattttcagcgccctcccttcactcagagcaagctggttcgctgtgtcaaaggtgcagta
cttgatgtggctgtcgatatccgcaaaggcagccccacctatggccagcatgtggctgta
gaacttaccgaggataatcatcgtcagttctttatccccaagggattcgctcatggcttt
gcagtgttgagtgaaacagcagtattccaatacaagtgcgatgagttctatcaccctgag
gctgatggcggcatcagtatcttagatgaaagtctgaatatcgattggcatatcccaacg
gataaagccatcctctccgacaaggataccaaacatcccctcctcaaagattttgagact
cctttcaattactaa

DBGET integrated database retrieval system