KEGG   Prevotella ruminicola: PRU_0424Help
Entry
PRU_0424          CDS       T01212                                 

Gene name
galM_1
Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
pru  Prevotella ruminicola
Pathway
pru00010  Glycolysis / Gluconeogenesis
pru00052  Galactose metabolism
pru01100  Metabolic pathways
pru01110  Biosynthesis of secondary metabolites
pru01120  Microbial metabolism in diverse environments
pru01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pru00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PRU_0424 (galM_1)
   00052 Galactose metabolism
    PRU_0424 (galM_1)
Enzymes [BR:pru01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     PRU_0424 (galM_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADE83238
UniProt: D5EX31
Position
complement(514095..515249)
Genome map
AA seq 384 aa AA seqDB search
MGVGAAALMLSCAGSQQAPQLTVSGLNPAKFDTTIQSKPVKLYTLKNENGMEVCITNYGA
RIVSLVVPDKDGKPTDVVLGFDNIAQYADTINTPSDYGSSVGRYANRIKNGQFLLKGDTV
QLRTNDGPNSLHGGGNTGWMHQVYEAEQIGDSILKLTIVAADGENGFPGKVMAVTTYKLT
ADNVLDMTWEAETDKPTIINQTNHNYYNLSGDFTQPAYDMVLYVNADNFTPSDKLYIPTG
EIKSVEGTPMDFRQPHALGDSINSQFDQIQNATGYDHNYCLNTFKDGKGDDTQVCASLYS
PKTGILMEMFTNEPGVQVYSGNFQGVGADKDIARKHGITYPKHVSVCLESQKYPDSPNHP
EWVQPTLNPGEKYYSHAAYKFSIK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgggagttggtgcagctgcactgatgctctcatgtgcaggaagccagcaggctccacag
ctcacggtatcgggtttgaacccagccaagttcgacactactattcagtcaaagccagtt
aagctttacacactgaagaacgagaatggtatggaggtttgcatcactaactacggtgcc
cgtatcgtatcgctggtagttcccgacaaggatggtaagccaaccgacgttgttctcgga
ttcgacaacatcgctcagtatgccgataccatcaacaccccatctgattacggctcaagc
gtaggtcgttatgctaaccgcatcaagaacggacagttcctgctgaagggcgacaccgta
cagctgcgcaccaacgatggtcctaactcgctgcacggcggtggcaacaccggttggatg
caccaggtttacgaggcagagcagattggcgactcaatcctgaagctcaccatcgtagct
gctgatggcgaaaacggattccccggcaaggtaatggctgttaccacctacaagcttaca
gccgacaatgtgctggatatgacttgggaggctgagaccgacaagccaactatcattaac
cagaccaaccacaactactacaacctgagcggcgactttacacagcccgcttacgacatg
gtactgtatgtaaacgctgataactttactcccagcgacaagctttatatccccacaggc
gagatcaagtcggttgagggcactccaatggacttccgtcagccacacgctctgggcgac
agcatcaactcgcagttcgaccagattcagaacgctacaggttacgaccacaactactgt
ctgaacaccttcaaggacggtaagggcgacgacacacaggtttgcgccagcctctacagc
cccaagacaggtatcctgatggagatgtttaccaacgagccaggtgtacaggtttacagc
ggtaacttccagggtgtaggtgccgataaggacatcgcccgcaagcatggcatcacctat
ccaaagcacgtgagtgtttgcttggagagccagaagtatcccgactcacctaaccatcct
gagtgggtacagccaaccctgaacccaggcgagaagtattacagtcatgcagcttacaag
ttctcaattaagtga

DBGET integrated database retrieval system