KEGG   Prevotella ruminicola: PRU_0656Help
Entry
PRU_0656          CDS       T01212                                 

Definition
(GenBank) glycosyl hydrolase, family 3
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pru  Prevotella ruminicola
Pathway
pru00520  Amino sugar and nucleotide sugar metabolism
pru01100  Metabolic pathways
pru01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pru00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PRU_0656
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    PRU_0656
Enzymes [BR:pru01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PRU_0656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: ADE83076
UniProt: D5EYH0
Position
769022..770197
Genome map
AA seq 391 aa AA seqDB search
MKIFKTWITAAVLFGGLLLTACTNDDNPSGSSAGSVEEQLRKMTLREKVGQMFYVRPEAL
DTTIHWSSFEELSPYKLQQINDCMAGVVKNYPIGGMILYAWNIEDENQLSSFISQIRALN
GSPLLCIDEEGGRVSRLANHPNFNLPKYESMESIGETGDPANAYECANTIGTYLTRYGFD
IDFAPVADVNTNPDNVVIGKRAFSSDPAVAASMVTSYLQGLKDAGITGCIKHFPGHGDTT
ADTHYGYAKSMKTWDEMMDCEMVTFRAGIAWGCELIMTAHIATPNVTGTDEPATMSPVIL
KDKLRGELGYRNIIVTDAISMGAITKQYTNAEAAVGCIKAGADIVLDPRNLVEAFDAVIA
AVNDGTLSEARINQSVRRILTLKQQIRNRTK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttttaaaacatggattaccgccgcagtgctttttggcggattgctgttaaca
gcttgtactaacgatgacaaccccagtggcagctcggccggtagcgttgaggagcagctg
cgaaaaatgacccttcgtgaaaaagtaggtcagatgttctacgtgcgccccgaggccctc
gacaccacgatacactggagcagtttcgaagaactttcgccctacaaactgcagcagatt
aacgattgcatggcaggtgtggttaagaactatcccataggtggcatgatactctatgcc
tggaacatcgaagatgaaaaccaactctcttctttcatctcgcagatacgtgctctcaat
ggtagtccgttgctgtgtatcgacgaggagggcggtcgcgtgtcgcgcctggccaaccat
cccaacttcaatctgcccaaatatgagtcgatggagtcgattggcgaaaccggcgatccc
gccaatgcctacgagtgcgctaacaccatcggcacctatcttacccgttatggtttcgac
atcgattttgccccagtggccgatgtcaacaccaatcccgacaatgttgtgattggtaag
cgcgccttcagtagcgatccggctgtggcagcatccatggtaaccagctacctgcagggg
ctgaaagatgctggcatcacgggctgcatcaagcatttccccggacatggcgacaccact
gccgacacccattacggctatgccaaatctatgaagacctgggacgagatgatggattgc
gagatggtaaccttccgtgcaggtatcgcctggggctgcgagctgattatgactgcccac
attgcaacccccaacgtgactggtactgatgagcccgccaccatgtcgcccgtcatcctt
aaggataagctgcgtggcgagttaggctatcgtaacatcatcgttaccgacgccatcagc
atgggcgccattaccaagcagtacaccaacgccgaagccgctgtgggctgtatcaaggcc
ggtgcagatatcgtgctcgatccccgcaatctggtcgaggccttcgatgccgtgatagcc
gccgttaacgatggcaccctcagcgaggcccgcatcaaccagagtgttcgccgcatccta
accctcaagcagcaaatccgcaaccgcaccaagtaa

DBGET integrated database retrieval system