KEGG   Prevotella ruminicola: PRU_2794Help
Entry
PRU_2794          CDS       T01212                                 

Gene name
agp
Definition
(GenBank) glucose-1-phosphatase
  KO
K01085  glucose-1-phosphatase [EC:3.1.3.10]
Organism
pru  Prevotella ruminicola
Pathway
pru00010  Glycolysis / Gluconeogenesis
pru01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pru00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PRU_2794 (agp)
Enzymes [BR:pru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     PRU_2794 (agp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-ProteinID: ADE82794
UniProt: D5EY75
Position
complement(3446154..3447563)
Genome map
AA seq 469 aa AA seqDB search
MKKLLLLMLAAMTATISTQAQTKRSADFKAKYQLKEVVVMSRHNIRSPLASGGATYMRVT
PYEWFKWTSPGSQLSLRGGVLETEMGQFFRKWLVGEGLLPDNYRPDGDDVLFYANSRQRT
FATAKYFSAGFLPFANVEIKHKYEEDKMDPLFTPQFTKMNDTYRQQVLAEINAMHNGPQA
WMQSVQPTLTLVEEIIDMAHSPAAQNDTTHFWYDDTQFTLEKGDEPKMTGGFKLANSVAD
ALVLQCYESESLSAFGHELTQEQWRAICGIKEVYDALLFTTHSAAVNLAYPLVSRIREEL
HHDRRKFTFLCGHDSNLASIGAALRLVYPETEQALELHTPIGSKLVFEKWSNGTDEYVAI
NLVYQSVSQLQNRTLLSVEEPPMILPVTIEGLTANSDGLYRLSDLDARMAETMTEYDAIK
DTEASAIPAPATTIPSGSARSYTLSGTLAPNSYRGIVIEQGHKTARTKY
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactacttttattaatgcttgctgccatgacagcaacaatcagtacacaggca
cagacaaagcgatcggccgacttcaaagctaagtatcagctgaaggaggtcgtagtgatg
agtcgccacaacatccgctcaccactggcatcgggcggtgccacctatatgcgagtaacg
ccttatgaatggtttaagtggacatcgccaggcagtcagttatcattgcgtggcggcgta
cttgaaacagagatgggacagtttttccgcaaatggttggtaggcgaaggactgctgccc
gacaactaccgtcccgatggcgacgatgtgctgttctacgccaactctcgccagcgtaca
tttgccacagctaagtatttctcagccggattcctgcccttcgccaacgtggagattaag
cacaagtacgaggaggacaagatggatcccttgtttacgccacagttcacaaagatgaac
gatacctaccgccagcaggttctcgccgagataaacgccatgcacaacggtccacaggct
tggatgcagtctgtacagcccaccctaacgctggtagaggaaatcattgatatggcgcac
tcaccagcagcgcagaacgacacaacgcacttctggtacgatgacacgcagtttacatta
gagaagggcgacgaaccaaagatgacaggcggctttaagctggccaatagcgtagccgac
gctctggtgctgcaatgctacgaaagcgagagcttgtcggccttcggccatgagttgact
caggagcaatggcgagccatctgcggcatcaaggaggtatacgacgctttgctcttcaca
actcatagtgctgccgtaaacctggcttacccattagtgagtcgtatccgtgaagaactg
caccacgaccgacgtaagttcacattcctctgtggtcacgacagcaatctggccagtatc
ggtgcagccctgcgtctcgtatatccagaaaccgaacaggctctggaactacataccccc
atcggttctaaactcgtgttcgagaagtggagcaacggtacagatgagtacgttgccatc
aatctggtatatcagtccgtcagtcagttacagaaccgcacattgctttctgtcgaagag
ccacctatgattctccccgtcaccatcgaaggactgacggctaatagcgatggactctat
cgtctgtcagatctcgatgcccgcatggccgaaacaatgacggaatacgatgccatcaaa
gacaccgaggcttccgccatcccagctcctgccaccaccattccctccggctctgcccgt
tcctacacactcagcggaaccctggctcctaatagttaccgaggaatcgttatcgaacaa
ggccataagaccgcaagaacaaaatactag

DBGET integrated database retrieval system