KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_0577
Entry
PsycPRwf_0577     CDS       T00541                                 
Name
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
prw00230  Purine metabolism
prw01100  Metabolic pathways
prw01232  Nucleotide metabolism
Module
prw_M00050  Guanine ribonucleotide biosynthesis, IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:prw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PsycPRwf_0577
Enzymes [BR:prw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PsycPRwf_0577
SSDB
Motif
Pfam: Guanylate_kin MMR_HSR1 AAA_33 AAA_18 MobB AAA_22 AAA_25 AAA_19 AAA_16 ATP-synt_ab cobW RsgA_GTPase
Other DBs
NCBI-ProteinID: ABQ93532
UniProt: A5WCZ1
Position
complement(694250..694864)
AA seq 204 aa
MKGSLFIITAASGTGKTSLVKQLIATTNDLAVSVSHTTREPRPGEIHGQHYHFTDTAKFI
EGIQAGEFLEHAQVFDNYYGTSRQSVNQQLESGVDVILEIDWQGALQVKELYEDVTMIFI
LPPSQATLRQRLSSRGQDSQEVIEKRLAGAVTEMQQYVHFDYVVINDQFEAALSELKAII
VAKRQTLARQQARYAEVIKDLITE
NT seq 615 nt   +upstreamnt  +downstreamnt
atgaaaggctccctttttattatcacagccgcttcaggcacaggtaagacatctttagtt
aaacagcttatcgccaccaccaatgatttggctgtcagcgtctcacacaccacccgcgag
ccgcgtcccggtgaaatccatggccagcactatcattttaccgatacagccaagtttatc
gagggcattcaggccggtgagtttttggagcatgcgcaggtttttgataattattatggc
acgtcacgccaaagcgtaaaccagcagcttgagtctggggtcgatgtgatcttagagatt
gactggcaaggcgcgttacaggttaaagagctgtatgaggatgtgaccatgatttttatt
ttgccaccaagccaggccacgttacgtcagcgcctctcctcacgtggtcaagactcccaa
gaggtaatcgaaaagcgcttggctggtgcggtgactgaaatgcagcaatacgtgcacttc
gattatgtggtgattaatgatcaatttgaagccgctttgtctgagttaaaagcaattatt
gtggccaagcgtcaaacgctcgcccgccagcaagcgcgttatgctgaagttatcaaagac
ttaatcactgaataa

DBGET integrated database retrieval system