KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_0176Help
Entry
PsycPRwf_0176     CDS       T00541                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
prw00471  D-Glutamine and D-glutamate metabolism
prw00550  Peptidoglycan biosynthesis
prw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    PsycPRwf_0176
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PsycPRwf_0176
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:prw01011]
    PsycPRwf_0176
Enzymes [BR:prw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     PsycPRwf_0176
Peptidoglycan biosynthesis and degradation proteins [BR:prw01011]
 Precursor biosynthesis
  Amino acid ligase
   PsycPRwf_0176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C NAD_binding_8 Pyr_redox_2 DAO NAD_binding_2 Shikimate_DH Thi4 F420_oxidored UDPG_MGDP_dh_N TrkA_N
Motif
Other DBs
NCBI-ProteinID: ABQ93135
UniProt: A5WBU4
Position
211558..213015
Genome map
AA seq 485 aa AA seqDB search
MSHYTPAHTDQTEPQSGGLIQKGEGLQVVIGLGQSGLATANYLARRGYKVAVTDGNSAPK
LAEQLEPNISIRAFGDIDAELLLQASRIIISPGVSLATPAVAAAKQAGIAIVSDIQLFKE
ACKAPIVAITGSNAKSTVTTLVGQMAKDAGVNVGVGGNIGVPALSLLEDEALGEAMQLAV
LELSSFQLETVTNLGAKVATVLNMSPDHLDRHGDMLGYHQAKHRIFQGAQSVVVNRDDAL
SRPLIADNTPRLSVGSGAPDLGEYGLITEGDGRIYLAKGTEKLLAADQLKVKGKHNLVNA
LAALALGGLAGLPKQSMLKTLQEFSGLPHRCQFVDNVAGVDYFNDSKGTNVGSTLAAILG
LGSVYGNQSGAKTKLMLILGGQGKGQQFGELVPLINKYVSQILLIGQDAELIESHLQQAN
LSGDVETHQCHDLAQAMTKANSLLSSSLSQVTTVLLSPACASLDQYPSYAKRGEHFCELV
GKLKD
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgcattacacccctgcgcatacagatcaaactgagccacaaagtggtggcctgatt
caaaaaggcgaggggctacaggtggtaatcggtctgggtcaatcaggtttggctacagcc
aactatctggcccgccgcggctataaggtggcggtaactgatggcaatagcgcccctaag
cttgctgagcagttagagccgaatatcagcattcgtgcatttggtgacattgatgcagaa
ctgttgttacaagcctcacgtatcattattagcccaggggtatcgctggcgacaccggct
gtggcggcggctaaacaggctggcattgccattgtgagtgatattcagctgtttaaagaa
gcgtgcaaggcgccgattgttgccattactgggtctaatgccaaaagtaccgtcaccact
ttggtgggtcaaatggccaaagatgcgggcgtgaatgtgggtgttggtggcaatattggg
gtaccggcgctgagtctcttagaagatgaggcgcttggtgaggccatgcagcttgcggta
ttagagttgtcgagctttcagctagagacagtgaccaatcttggcgcaaaagtggccact
gtgcttaatatgtcgccggatcacttagaccgtcatggcgatatgctcggctaccatcaa
gccaagcaccgtatcttccaaggggcacagtcggtcgtggttaaccgtgatgatgccttg
tctcgccctttaattgcggataatacgccgcgtctaagtgtcggatctggcgcccctgat
ttgggcgaatatggtctaattacagaaggcgatgggcgcatttatttggccaaaggcact
gagaagttattggcagcagatcagctcaaagttaaaggcaagcataatctggttaatgcg
ttagccgccttggcgcttggggggcttgctggcttgccaaaacagagcatgttaaaaacg
ttacaagagttttctggactgccacaccgctgtcaatttgtggataatgtggcgggcgtg
gattatttcaatgattctaaaggcaccaatgtcggctcaactttggcggccattttgggt
ttaggctcagtgtatggcaatcaaagtggcgctaagaccaagttgatgctgattttaggc
gggcagggcaaaggtcagcagtttggcgagcttgtgcctttaattaataaatacgtcagc
caaatcctactgataggacaagatgccgagctaatagagtcgcatttgcagcaggccaat
ttaagtggtgatgtcgagactcatcagtgccacgacttggctcaggcgatgacgaaagca
aacagcttattatcgagcagcctatcacaagtaactaccgttttattatcgcctgcttgt
gccagcttagatcagtatcctagctatgctaagcgtggtgagcacttttgtgagctggta
ggtaagctcaaagattag

DBGET integrated database retrieval system