KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_0246Help
Entry
PsycPRwf_0246     CDS       T00541                                 

Definition
(GenBank) transferase hexapeptide repeat containing protein
  KO
K13018  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase [EC:2.3.1.201]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
prw00520  Amino sugar and nucleotide sugar metabolism
prw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PsycPRwf_0246
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:prw01005]
    PsycPRwf_0246
Enzymes [BR:prw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.201  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase
     PsycPRwf_0246
Lipopolysaccharide biosynthesis proteins [BR:prw01005]
 Unusual sugar
  PsycPRwf_0246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2 DUF4954
Motif
Other DBs
NCBI-ProteinID: ABQ93201
UniProt: A5WC10
Position
complement(286731..287312)
Genome map
AA seq 193 aa AA seqDB search
MNNYYQHPSAIIDNGAIIGNDTRVWHFVHICSGAVIGSRCSLGQNVFVGNKVIIGDDCKI
QNNVSVYDNVTLEDGVFCGPSMVFTNVYNPRSFVDRKSEFMSTLIKTGATLGANCTIVCG
NTIGKFAFVGAGSVVNKDVPDYALMVGVPARQIGWMSEYGERLDLPLTGKGDAYCEHTGA
QYTLANGIVTKSK
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgaataattattaccaacatcctagtgcaatcattgacaatggtgcaatcataggtaac
gacactcgtgtatggcattttgtgcatatctgttcaggagcagttattggaagtcgatgc
tctttaggacaaaatgtttttgttggtaataaagtgattatcggagatgactgtaaaata
caaaataatgtttctgtctacgataacgttactttagaggatggggtattctgtggtccc
agcatggtatttaccaatgtctataatcccagatcctttgttgatagaaagtctgagttt
atgagtacgctgattaaaaccggtgctaccttaggtgcaaactgtacgattgtttgtggt
aataccatcggtaagtttgcctttgtaggcgcaggtagtgttgtcaataaggatgtacca
gattatgcactgatggtaggtgttcctgcgcgtcaaatcgggtggatgagtgaatatggc
gagcgcttagacttacctctgacaggcaaaggtgatgcttactgtgagcatactggcgca
caatatacacttgccaatggcatcgtaactaagagcaaatag

DBGET integrated database retrieval system