KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_0262Help
Entry
PsycPRwf_0262     CDS       T00541                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
prw00020  Citrate cycle (TCA cycle)
prw00190  Oxidative phosphorylation
prw00650  Butanoate metabolism
prw01100  Metabolic pathways
prw01110  Biosynthesis of secondary metabolites
prw01120  Microbial metabolism in diverse environments
prw01130  Biosynthesis of antibiotics
prw01200  Carbon metabolism
Module
prw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
prw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
prw_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:prw00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PsycPRwf_0262
   00650 Butanoate metabolism
    PsycPRwf_0262
  Energy metabolism
   00190 Oxidative phosphorylation
    PsycPRwf_0262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_C CybS
Motif
Other DBs
NCBI-ProteinID: ABQ93217
UniProt: A5WC26
Position
308608..308991
Genome map
AA seq 127 aa AA seqDB search
MRRNDSGIKSATGLTGSGSRDWVMQRISAVVLAIYAVVMVGFFLINGDVSYQQWVSFIMS
LPMRLLSLVAIIALAAHAWVGMWTVFTDYVKSTGLRLVLQAAMIIAILVYLFWGVMIFWG
PGLLNLG
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgagaagaaatgattctggaattaaaagtgcgacaggcctaaccggctcaggctcgcgc
gactgggtaatgcagcgtatcagtgccgtcgtattggccatatatgctgtggtaatggta
gggtttttcttaattaatggtgatgtatcctaccagcagtgggttagcttcattatgagc
ctgcccatgcgcctattaagcttggtcgcaattattgcgctagcggctcatgcttgggta
gggatgtggacggtatttaccgactatgttaaatctactggcctacgccttgtgcttcaa
gctgctatgattatcgcaattttggtatacctattctggggcgtcatgattttctggggt
ccaggtttactaaacctaggttaa

DBGET integrated database retrieval system