KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_0904Help
Entry
PsycPRwf_0904     CDS       T00541                                 

Definition
(GenBank) L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
prw00260  Glycine, serine and threonine metabolism
prw01100  Metabolic pathways
prw01110  Biosynthesis of secondary metabolites
prw01120  Microbial metabolism in diverse environments
prw01130  Biosynthesis of antibiotics
prw01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:prw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PsycPRwf_0904
Enzymes [BR:prw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     PsycPRwf_0904
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5 Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ABQ93854
UniProt: A5WDW3
Position
complement(1075488..1076540)
Genome map
AA seq 350 aa AA seqDB search
MFHFLNDYSESAHPDIITAMHDAHLQQHKGYGFDEYSERVRDQIKAQLSDPDIAIHFGIT
GTQANLVCIDAMLTPIDGIIACDTGHIAVNEAGAIEATGHKVILAESKDGKLTIEALDKV
RVRHSFTPHVVRAKAVYISNTTELGTVYSYHELKAISDYCRKHDMYLFMDGARLGAAIAS
SHANPNDKDMSIADYAQLTDIFWFGGTKMGAMFGEILIIPNKKIATDFNIYLKRHGGLMA
KGYLLALQFEVLLKDNKYLELCHHANTMAKKLAEGIQSCGIELFVPAQSNQVFALMPQAL
IATLKNDFEFYEWEQLDNGFSIARLVTSWATPEMQVDRFIQLLQKATSNN
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtttcattttttaaacgattatagcgaaagcgcccaccctgacatcatcactgccatg
cacgatgcccacttacaacaacataaaggctatggcttcgatgagtactctgagcgggta
cgcgaccaaataaaagcacagctgtctgatccagatattgccattcactttggtatcaca
ggcactcaggccaacttggtatgcatcgatgccatgctgacccctattgatggcatcatt
gcctgtgataccggccatattgcggtcaatgaggccggcgctattgaggcgacaggacac
aaagttattttggcggagtctaaagatggcaaattgaccatagaggctttagataaggtg
cgagttcgccacagtttcacgccgcatgtcgtgcgtgccaaagccgtctatatctccaac
accacagagcttggtaccgtatatagttatcacgagcttaaggccatctcagattattgc
cgcaagcatgatatgtatctatttatggatggggcacggttgggtgctgccattgccagt
agccatgctaatcctaatgataaggacatgagtatcgctgattatgcccagctaaccgat
atattttggttcggtggcactaagatgggggctatgttcggtgagattttgatcattcct
aataaaaaaatcgccaccgattttaatatttacctaaagcgtcatggcggcttaatggcc
aaaggctatcttctggcgttacaatttgaggtattgttaaaagacaacaaatatcttgag
ctgtgccatcatgccaacactatggccaaaaagttagcggaaggcatccaatcttgtggc
attgagctatttgttcctgctcaaagtaaccaagtatttgcacttatgccgcaggcgctg
attgccaccttaaaaaatgacttcgaattttatgaatgggagcagctagataacggcttt
agtatcgcccgcttggtcacctcttgggccacacctgagatgcaagtggatcgattcata
caactgttacaaaaggccacctcgaataactaa

DBGET integrated database retrieval system