KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_1390Help
Entry
PsycPRwf_1390     CDS       T00541                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
prw00071  Fatty acid degradation
prw00072  Synthesis and degradation of ketone bodies
prw00280  Valine, leucine and isoleucine degradation
prw00310  Lysine degradation
prw00362  Benzoate degradation
prw00380  Tryptophan metabolism
prw00620  Pyruvate metabolism
prw00630  Glyoxylate and dicarboxylate metabolism
prw00640  Propanoate metabolism
prw00650  Butanoate metabolism
prw00900  Terpenoid backbone biosynthesis
prw01100  Metabolic pathways
prw01110  Biosynthesis of secondary metabolites
prw01120  Microbial metabolism in diverse environments
prw01130  Biosynthesis of antibiotics
prw01200  Carbon metabolism
prw01212  Fatty acid metabolism
prw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:prw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PsycPRwf_1390
   00630 Glyoxylate and dicarboxylate metabolism
    PsycPRwf_1390
   00640 Propanoate metabolism
    PsycPRwf_1390
   00650 Butanoate metabolism
    PsycPRwf_1390
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PsycPRwf_1390
   00072 Synthesis and degradation of ketone bodies
    PsycPRwf_1390
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PsycPRwf_1390
   00310 Lysine degradation
    PsycPRwf_1390
   00380 Tryptophan metabolism
    PsycPRwf_1390
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PsycPRwf_1390
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PsycPRwf_1390
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PsycPRwf_1390
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:prw04147]
    PsycPRwf_1390
Enzymes [BR:prw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PsycPRwf_1390
Exosome [BR:prw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PsycPRwf_1390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt CDC45 Macoilin
Motif
Other DBs
NCBI-ProteinID: ABQ94335
UniProt: A5WF94
Position
1705218..1707044
Genome map
AA seq 608 aa AA seqDB search
MSNSNQSNKSADKSSAVTSTVVNKAGESLLNDTNNAAPTKDSNTTSDFSKLQQEVVSTSK
TEADTVISEDRAAKQKIIAEAKAQAQQEDNLSQIDEPAQEATQVKDNKADDAQTQKESNQ
TESKQAQEQATKSTAEAPKQEASDSTNQTQKQSGDKPANQSPADKSKTNKESSMSDNSKT
SNLPRRVAILGGNRIPFARSNGPYADASNIDMLSAALNGLVERYELQGERVGEVVAGAVL
KLSRDLNLTRESALNTALDPQTPAYDVSQACGTGLQATFAASNKIALGIIDSAITGGVDT
TSDAPIAVGDGLRKALIKLGAARNNKQRLSALTSINPKELIDAPQNGEPRTGLSMGDHQA
ITALEWNISREAQDELAVKSHQNLARAYEEGFFDDLITPYKGLTRDNNLRPDSSLEKLAT
LKPVFGKRNANPTMTAANSTPLTDGASCVLLGTDEWAEAHGLKPLAYIVHQETAAVDFIG
KNGPKEGLLMAPAYAVPRMLARAGLTLQDFDFYEIHEAFASQVLSTLAAWEDETFCKERL
GLDAPLGSIDRSKLNVNGSSLAAGHPFAATGGRILATAAKLLDQKGSGRALISICAAGGQ
GVTCILEK
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgagtaattctaatcaatcaaataaatctgctgacaaatcctctgcggtgacatccact
gtggtgaacaaagcgggtgagtcattactaaacgatactaacaatgccgccccgaccaaa
gactcaaacaccacatcagacttctcaaaattacagcaagaagtcgtctccacctcaaaa
actgaggcagataccgtcatcagcgaagatcgcgctgccaaacaaaagattattgccgaa
gccaaagcacaagcacaacaagaagacaatctgtctcaaatcgatgagcctgcgcaagaa
gccacacaagttaaagacaataaagctgacgacgctcaaactcaaaaagagtctaatcaa
actgaatctaaacaagcgcaagaacaagccaccaaatctactgctgaagcgcccaagcaa
gaagcttcagacagcaccaatcaaacccaaaaacagtctggtgataagcccgctaaccaa
tcacctgctgataagtcaaaaaccaacaaggaaagctcaatgtcagacaattcaaaaacc
tcgaatcttcctcgccgcgtcgctattttaggcggtaaccgtattccatttgcacgctct
aatggtccctatgctgacgccagcaacattgacatgttaagcgccgctttaaacggtctg
gttgagcgttatgaattacaaggtgagcgtgttggtgaagtcgtggccggtgcggtatta
aaactaagccgtgacttaaacctaacccgtgagtcagcgcttaataccgctcttgaccca
caaacgcctgcctatgatgtctctcaagcctgtggcactggtttacaagccacttttgct
gccagcaataaaattgctctaggcattatcgattcggccattactggtggtgtggacacc
acttcagatgcccctattgctgtgggtgatggtctacgcaaagccttaatcaaactgggc
gccgctcgcaataacaaacagcgcctaagcgccctaaccagcatcaatccaaaagagctt
atcgatgcgccgcaaaatggtgagccacgtaccggtctatctatgggtgatcaccaggcc
attaccgctttagaatggaacatcagccgtgaagcacaagatgagttggcagtaaaaagc
catcaaaacctagcccgtgcttatgaagagggcttctttgatgacctaattaccccatac
aagggcttaacccgtgataacaacttacgtccagactcttcactagaaaaattagcgacg
ctaaaacctgtatttggtaaacgtaacgctaacccaaccatgacagcagccaactctacc
cctctaaccgatggtgcttcttgtgtcctactgggtacagatgagtgggctgaagctcat
ggcctaaaaccactggcttatattgtccatcaagaaactgctgctgttgattttattggc
aaaaatggccctaaagaaggtctgttaatggcacctgcttacgctgtacctcgtatgctt
gcacgtgctggcctaactttacaagactttgacttctatgaaatccatgaagccttcgcc
tcacaagtgctgtcgactctagccgcctgggaagatgagactttctgtaaggagcgtttg
ggtcttgatgccccactaggatctattgaccgcagtaaactaaacgttaatggctcatca
ctggctgcaggccatccatttgcagcaaccggtggtcgtatcctagccactgctgctaag
ttactggatcaaaaagggtcaggccgtgcactgatttcaatctgtgcagcaggtggtcaa
ggtgtcacttgtattttagaaaaataa

DBGET integrated database retrieval system