KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_1600Help
Entry
PsycPRwf_1600     CDS       T00541                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
prw00330  Arginine and proline metabolism
prw00332  Carbapenem biosynthesis
prw01100  Metabolic pathways
prw01130  Biosynthesis of antibiotics
prw01230  Biosynthesis of amino acids
Module
prw_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:prw00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PsycPRwf_1600
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    PsycPRwf_1600
Enzymes [BR:prw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PsycPRwf_1600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ABQ94541
UniProt: A5WFV0
Position
complement(1970059..1971276)
Genome map
AA seq 405 aa AA seqDB search
MSAKKKPKNLHTVKPSIPKPTALDDDRFATEDRSFDLQRIIVKIGSSLLTNNGKGLDRTA
IYEWASQIAKLHNQGKEVILVSSGAVAEGLVRMGLDERPKKLEALQACAAIGQMGLIETW
SSALIQSGVRSAQILLTHDDLSNRQRYLNTANTLDKLLSWRVIPVINENDTITVDEIKFG
DNDTLGAMAAAMVSADLYIILTDQDGVFTDNPRENPDAKMIRQERAMADYLFDIAGEGGK
LGSGGMLTKIRAGRLAAMGGCPTVIANGSIDKVITRVVEGESVGTLLKTNQADKIIARKQ
WLAAHLRMAGTLYIDAGAVHAITVQGKSLLPVGVVDIQGDFDEGDVVAVVDETTKERIAV
GQVNFSSEDAQRVARNRTHNFDKILGGSEERVVMIHRDDMAILNK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctaagaagaaaccgaaaaatttacataccgtaaagccaagtatccctaagccc
accgctttagatgacgaccggtttgctacagaagatcgatcatttgatttgcagcggatt
attgtaaaaattggctcttcactgcttaccaataatggtaaaggacttgaccgcaccgcc
atttatgagtgggccagtcaaattgccaagctacacaatcaaggcaaagaggtaattttg
gtttcctcaggtgctgtggcagaaggtttggtaagaatgggtcttgatgagcgtcccaaa
aagcttgaggcgctacaagcatgtgctgctattggtcaaatggggctgattgaaacttgg
tcttcagccttgattcaaagtggggtgcgtagtgctcaaattctattgacccatgatgat
ttatccaaccggcagcgttatctaaataccgccaatactttagataagctgctgtcttgg
cgagtgatccctgttattaacgaaaatgacaccattactgtcgatgaaattaagtttggt
gataatgataccctaggcgctatggcagcggctatggtcagcgccgatttgtacatcatc
ttaaccgatcaagatggggtgtttaccgataatccacgcgaaaatcccgatgccaaaatg
attcgtcaagagcgagcaatggcagattacttgtttgacattgcaggagagggcggcaaa
ctcggtagtggtggtatgctcaccaaaattcgggcgggtcgattggctgcgatgggcggt
tgcccgactgtgattgccaatggcagtatcgataaagtcattacccgagtggttgagggt
gagtcggtgggcactttattaaaaaccaatcaggccgataagattattgcccgtaagcag
tggcttgctgcgcatttgcgtatggcaggcacgttgtatatcgatgccggtgcggtacat
gccattaccgtacaaggcaagagcttattgcctgtaggcgtggtagatatccaaggcgac
tttgatgaaggcgacgtggtggctgtggtggatgagacgaccaaagagcgtattgccgtg
ggtcaagtcaatttctcctcagaggatgcgcagcgtgtggcgcgtaatagaacccataac
tttgataaaatattagggggttcagaggagcgcgtggttatgattcatcgcgatgacatg
gccatattaaataaatag

DBGET integrated database retrieval system