KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_1648Help
Entry
PsycPRwf_1648     CDS       T00541                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
prw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
prw01100  Metabolic pathways
prw01110  Biosynthesis of secondary metabolites
prw01130  Biosynthesis of antibiotics
prw01230  Biosynthesis of amino acids
Module
prw_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:prw00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PsycPRwf_1648
Enzymes [BR:prw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PsycPRwf_1648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ABQ94588
UniProt: A5WFZ7
Position
2037011..2037856
Genome map
AA seq 281 aa AA seqDB search
MTHDAIPSILKKIVLTKESEVASAKAQQALPAIRAEAEQLAASQEAPRRGFAQALLAKQS
AGVPGIIAEVKKASPSKGIISPNFDPSRVAKQYEQAGAVCLSVLTDEQYFQGHNSYLQQA
KAACSLPVLRKDFMIDEYQIYQSYLLGADCILLIVACLDDKQLHHLHELACKLSMDVLIE
VHTLHELERALKLPASEHNIYGINNRDLNTFNTDLQTSIKLKEFLDNQSAKPQLLVTESG
IHSTEDMQLMLTHHINCFLIGEQFMKTEHPGDTLAALLSSL
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgacgcatgatgccatcccctcaatcctaaaaaaaattgtgctgaccaaagagtctgaa
gtggccagtgccaaagcacaacaagcgctgcctgcgattagagctgaggctgagcagctt
gctgcctctcaagaggcccctcgccgcggttttgcccaagcgttattggccaaacaaagc
gctggcgtgccaggcatcattgctgaggtcaaaaaggcgtcaccatcaaaggggattatc
tcacctaactttgatcctagccgagtcgctaagcaatatgagcaagctggtgctgtctgt
ctgtctgtactgactgatgagcagtattttcaaggccataacagctacttacaacaggcc
aaagccgcttgtagcttacccgtacttcgcaaagactttatgattgatgagtatcagatt
tatcagtcctacctactgggcgctgactgtattttgttaattgttgcctgcttagatgac
aagcaattacatcatctacatgagttggcctgcaaacttagcatggatgtccttatcgaa
gtgcatacccttcatgagctagagcgcgccctaaagctaccggcgtctgagcacaatatt
tatggcataaataaccgcgatttaaacacctttaatactgacctacaaacctccataaaa
ctcaaagaattccttgataatcagtcagccaaacctcagctgttggtgaccgaaagtggc
attcatagcactgaggatatgcagctaatgctcactcatcacataaactgctttttaatt
ggcgagcagtttatgaaaactgagcatccgggcgacaccctagccgccctactcagctca
ctgtaa

DBGET integrated database retrieval system