KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_2380Help
Entry
PsycPRwf_2380     CDS       T00541                                 

Definition
(GenBank) Alcohol dehydrogenase, zinc-binding domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
prw  Psychrobacter sp. PRwf-1
Pathway
prw00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:prw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PsycPRwf_2380
Enzymes [BR:prw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     PsycPRwf_2380
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     PsycPRwf_2380
    1.1.1.-  
     PsycPRwf_2380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C FAD_binding_3 NPH-II ATPase ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ABQ95320
UniProt: A5WI29
Position
2966766..2967830
Genome map
AA seq 354 aa AA seqDB search
MKAARFYDKGDIRIEDIPEPTVKPGTVGIKVAWCGICGTDLHEFMEGPIFIPPCGHPHPI
SGESAPVTMGHEFSGVVYAVGEGVNDIEIGQHVVVEPYIVADDVPTGPGDNYHLSKDMNF
IGLGGRGGGLSEKIAVERRWVHPISNKIPLDQAALIEPLAVGYHAFIRSGAQKGDIALVG
GGGPIGLLLSAVLKAKGITVIMTELSEKRKEKAKESGVADYILDPTKVDLNKEVMKITED
RGVDVSFECTSVNAVLDSLVELTKPAGSVVIVSIWSHPAKIDVHSVVMKELDVRGTIGYV
NNHPETIKLVEDGLVDLEPFITQRIKLDDLVSKGFETLIHNNDSAVKIIVNPNL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcacgtttttatgataaaggtgatattcgtatcgaagatatcccagaacct
acggtaaaacctggtacagttggcattaaagtagcttggtgcggtatttgtggtactgat
ttgcatgagtttatggaagggcctatcttcattccaccctgtggacatccacatcccata
tcaggagagtcagcacctgttacaatgggtcatgagttttctggtgtggtttatgcggtt
ggtgaaggggtgaacgatattgaaattggccaacatgttgtagttgagccttatattgtt
gccgatgacgttcccacaggccctggtgataattaccacctttcaaaagacatgaacttc
attggtcttggcggccgcggtggtggcttgtcagaaaaaattgctgttgaacgtcgctgg
gtgcatcctatttcaaataaaatccctttagatcaggcagctttaattgagcctcttgca
gtgggttaccatgcttttatacgtagcggtgcacaaaaaggagatatcgctctagttggt
ggtggtgggcctattggcttgttgttatcggcggtattaaaggcaaaaggtatcaccgtt
attatgaccgagcttagcgaaaaacgtaaagagaaggccaaggaaagtggcgttgctgac
tacattttagacccgaccaaggttgacttgaacaaagaggtcatgaaaatcaccgaagat
cgcggtgtggacgtgtcttttgaatgtaccagtgtaaacgcagttttagattctttagtt
gagttgaccaagccagcaggatcggtagttattgtgtctatttggagtcatcccgccaaa
attgatgtccacagtgtggttatgaaagagcttgatgtacgtggcactattggttacgtt
aacaatcatccagagaccataaaactggttgaagatggtttggtagatcttgagccgttt
attactcaacgtattaaattagatgatttggtttcaaaaggatttgagactttgattcat
aataatgactccgctgttaagattatcgtcaatccaaacttataa

DBGET integrated database retrieval system