KEGG   Pseudomonas stutzeri A1501: PST_0163Help
Entry
PST_0163          CDS       T00511                                 

Definition
(GenBank) formate dehydrogenase accessory protein
  KO
K02380  FdhE protein
Organism
psa  Pseudomonas stutzeri A1501
Brite
KEGG Orthology (KO) [BR:psa00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    PST_0163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FdhE
Motif
Other DBs
NCBI-ProteinID: ABP77870
UniProt: A4VFW9
Position
complement(190641..191558)
Genome map
AA seq 305 aa AA seqDB search
MAGTILEPGQIEAAASKPPFTNLPPRDLFALRSARLAKLAEDHPLADYLRLLAGVCQAQQ
QVLDNPPASAPLDPARTRECFKHAMPPLAADTLVREGAWLPLLDAWLDAFAVPDNLSVIA
AVDQLRRADSGQRKAWAVALVSGQYDSLPPALVPFLGAALQLAWTHWLLQLDLSDLRERE
DQTLCPCCGAPPMAGVIRHRGQLNGLRYLVCSLCACEWHYVRLKCSHCRSTKKLDYLHFE
GSPQGIKAEACPECNGYLKQLYLELAPDGESLSADLATLDLDLLLADQGYNRQAPNLLLA
PGHEA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtggcaggcaccattctcgagcccgggcagatcgaagccgctgccagcaaaccacccttc
accaacctgccaccacgcgatctgttcgccctgcgcagcgcgcgcctcgccaagctcgcc
gaagatcatccgctggccgactacctgcgcctgctcgccggcgtatgccaggcacagcag
caggtgctggacaacccgcctgccagcgcaccgctcgaccctgcgcgcacccgcgaatgc
ttcaagcacgccatgccgccgctggccgccgacactctggtacgtgagggggcatggctg
ccgctgctcgatgcctggctggatgccttcgcggtgccggacaacctgtcggtgatcgct
gccgtcgaccagctgcgccgcgccgacagcggccagcgcaaggcctgggccgtggcgctg
gtcagtggccaatacgacagcctgccgccggcgctggtgccctttctcggcgccgcgctg
cagctggcctggacccattggctgctccagctcgacctctccgacctgcgcgaacgcgaa
gaccagacgctctgcccctgctgcggcgcaccgcccatggccggggtgattcgccaccgc
gggcagctcaacggcctgcgctacctggtctgctccctgtgcgcctgcgaatggcactac
gtgcgcctgaaatgcagtcactgccgcagcaccaagaagctcgactacctgcacttcgaa
ggctcgccccagggcatcaaggccgaggcctgccccgaatgcaacggctacctcaagcag
ctctatctcgaattggcaccggacggcgaaagcctgtccgccgacctggcgacgctggac
ctcgacctgctgctggccgatcagggctacaaccgccaggcacccaacctgctgctggca
ccggggcacgaggcatga

DBGET integrated database retrieval system