KEGG   Pseudomonas stutzeri A1501: PST_1526Help
Entry
PST_1526          CDS       T00511                                 

Gene name
pdxH
Definition
(GenBank) pyridoxine 5'-phosphate oxidase
  KO
K00275  pyridoxamine 5'-phosphate oxidase [EC:1.4.3.5]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
psa00750  Vitamin B6 metabolism
psa01100  Metabolic pathways
psa01120  Microbial metabolism in diverse environments
Module
psa_M00124  Pyridoxal biosynthesis, erythrose-4P => pyridoxal-5P
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PST_1526 (pdxH)
Enzymes [BR:psa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.5  pyridoxal 5'-phosphate synthase
     PST_1526 (pdxH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Putative_PNPOx PNP_phzG_C Pyridox_oxase_2
Motif
Other DBs
NCBI-ProteinID: ABP79211
UniProt: A4VJR0
Position
1638108..1638755
Genome map
AA seq 215 aa AA seqDB search
MIQTLADMRRDYTRDGLSEANAPDDPFGLFRQWFTEATQTEQAPVEPNAMSLATVDADGR
PHCRILLLKALDDRGFTFFTNYDSAKGQQLDASPYAAMTFFWPTLERQVRIEGRVEKVTA
EESDAYFQVRPLGSRLGAWASPQSQVIRDRAELERLLAETEQRFLDKAPHCPPHWGGYRL
LPERIEFWQGRPSRLHDRLDYRLVANGWQRERLAP
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgatccagaccctggccgatatgcgccgcgattacacccgtgacggactcagcgaggcc
aacgcgcccgacgaccctttcggtctgttccgtcagtggttcactgaggcaactcagacc
gagcaggcgcccgtcgaacccaatgccatgtctctggcaaccgtcgacgccgacggtcgg
ccccattgccgcatcctgctgctcaaggcgctggacgaccgcggttttacgtttttcacc
aactacgacagcgccaaggggcagcagctggacgcgtcgccctatgccgccatgacgttc
ttctggccgacgctggaacgacaggtccgtatcgaggggcgcgtcgagaaggtgacggca
gaggaatcggatgcctatttccaggtgcgcccgctgggcagtcggctcggagcctgggca
tcaccgcagagtcaggtgattcgcgatcgtgctgagctggagcggctgctggccgagacc
gagcagcgcttcctcgataaggcgccccattgtcctccgcactggggcggctaccggctg
ctgccggagcgcatcgagttctggcaggggcggccgagccgcctgcacgaccgactcgac
tatcgcctggtcgccaatggctggcagcgcgagcgcctggcgccctga

DBGET integrated database retrieval system