KEGG   Pseudomonas stutzeri A1501: PST_1723Help
Entry
PST_1723          CDS       T00511                                 

Gene name
acsA
Definition
(GenBank) acetyl-coA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
psa00010  Glycolysis / Gluconeogenesis
psa00620  Pyruvate metabolism
psa00640  Propanoate metabolism
psa00680  Methane metabolism
psa01100  Metabolic pathways
psa01110  Biosynthesis of secondary metabolites
psa01120  Microbial metabolism in diverse environments
psa01130  Biosynthesis of antibiotics
psa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PST_1723 (acsA)
   00620 Pyruvate metabolism
    PST_1723 (acsA)
   00640 Propanoate metabolism
    PST_1723 (acsA)
  Energy metabolism
   00680 Methane metabolism
    PST_1723 (acsA)
Enzymes [BR:psa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PST_1723 (acsA)
Lipid biosynthesis proteins [BR:psa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PST_1723 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABP79401
UniProt: A4VKA0
Position
1854173..1856128
Genome map
AA seq 651 aa AA seqDB search
MCAASVYPVSPEAAKHSLTDEAAYRAMYQQSVINPEGFWREQAARLDWIRPFSEVKRTSF
DDHHVDIKWFADGTLNVSANCLDRHLAERGDQVAIIWEGDDPSEHREITYRELYQEVCKF
ANALRGQDVHRGDVVTIYMPMIPEAAVAMLACARIGAIHSVVFGGFSPEALAGRIIDGSS
KVVITADQGIRGGKTIALKENVDEALTNPQTRCVQKIIVVRRTGANIRWYPHRDVSYDDL
MRVAGEVCAPKEMGAEEPLFILYTSGSTGKPKGVLHTCGGYLLYAALTHERVFDYRPGDI
YWCTADIGWITGHSYLIYGPLANGATTLMYEGVPNYPDVTRIARIIDKHRVNILYTAPTA
IRAMMAEGPAAMEGADGSSLRLLGTVGEPINPEAWHWYYETVGRSRCPIVDTWWQTETGG
ILISPLPGATALKPGSATRPLFGVVPGLVDNLGNLLEGPAEGNLVILDSWPGQMRTIYGD
HDRFVDTYFKTFRGMYFTGDGARRDEDGYYWITGRVDDVLNVSGHRMGTAEIESALVAHA
KVAEAAAVGVPHPLKGQAIYVYVTLVAGTEPSDTLRQELQQWVRHEIGPIAVPDTIQWAP
GLPKTRSGKIMRRLLRKIATDDYDTLGDTSTLADPGVVDQLIAAHEAVKQR
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgctgcgtccgtgtatcccgtgtcccctgaggctgcaaagcactccctgaccgac
gaggccgcttatcgggccatgtatcagcagtcggtgatcaaccctgaaggattctggcgt
gaacaggcggcacggctggactggattcggcccttcagcgaggtcaagcgcacctccttc
gacgaccatcacgtcgatatcaagtggtttgccgacggcacgctgaacgtgtcggccaat
tgcctggaccggcacctggccgagcgcggcgatcaggtggcgatcatctgggagggggac
gacccctcggagcaccgcgagatcacctaccgcgagctctaccaggaggtctgcaagttc
gccaacgctctgcgtggccaggatgtgcaccgcggtgacgtggtgaccatctacatgccg
atgattcccgaggccgcggtggcaatgctggcctgcgcgcgcatcggtgcgatccactcg
gtggtgttcggcggcttctcgccggaggcattggccgggcgcatcatcgatggcagctcg
aaggtggtgatcactgccgatcagggcatacgtggcggcaagaccatcgccctgaaggag
aacgtcgacgaggcgctgacgaacccgcagacccgttgcgtgcagaagatcatcgtggtg
cgccgcaccggagcgaacatccgctggtacccgcaccgggacgtctcctacgacgacttg
atgcgggttgccggcgaggtctgcgcgccgaaggaaatgggcgccgaggagccgctgttc
attctctacacctcgggctccaccgggaaacccaagggcgtgctgcacacctgcggcggc
tacctgctgtacgccgcgctgacccacgaacgggtcttcgactaccgccctggcgatatc
tactggtgcaccgccgacatcggctggattaccggtcatagctatctgatctacggccca
ctggccaacggtgcgacgaccctgatgtacgaaggcgtgccgaactatccggacgtcacc
cgcatcgccaggatcatcgacaagcaccgggtcaacatcctctacaccgcgccgacggca
atccgcgcgatgatggccgaggggccggcggcgatggagggtgccgacggttcgagcctg
cgcctgctcggcacggtgggcgaaccgatcaatccggaagcctggcactggtactacgag
acggtcggtcggtcgcgctgcccgatcgtcgatacctggtggcagaccgagaccggcggc
atcctcatcagcccgctacccggtgccacggcgctcaagcccggctcggcgacgcggccg
ctgttcggcgtagtgccggggctggtggacaatcttggcaacctgctggaaggcccggcg
gagggcaatctggtgattctcgactcctggccagggcagatgcgcaccatttacggtgac
cacgaccgtttcgtcgatacctacttcaagaccttccgcggtatgtacttcaccggcgac
ggcgcgcgccgcgacgaggacggttactactggatcaccgggcgcgtcgacgatgtgctc
aacgtctccggacaccgcatgggcaccgccgaaatcgagagcgccctggtggcgcatgcc
aaggtggccgaagccgcggccgttggcgtgccgcatccgctcaagggccaggccatctat
gtttacgtgactctggttgctggtaccgagcccagcgacacgctgcgccaggagctgcag
cagtgggtccggcacgagatcggcccgatcgcggtgccggataccattcaatgggcgccg
gggctgccgaagacacggtccggcaagatcatgcgccgcctgctgcgcaagatcgccacg
gacgactacgacactctgggcgatacctcgacgctggccgaccctggcgtcgtcgaccag
ttgatcgctgcccatgaggcggtgaagcagcgctga

DBGET integrated database retrieval system