KEGG   Pseudomonas stutzeri A1501: PST_2111Help
Entry
PST_2111          CDS       T00511                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
psa00040  Pentose and glucuronate interconversions
psa00052  Galactose metabolism
psa00500  Starch and sucrose metabolism
psa00520  Amino sugar and nucleotide sugar metabolism
psa01100  Metabolic pathways
psa01130  Biosynthesis of antibiotics
Module
psa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PST_2111 (galU)
   00052 Galactose metabolism
    PST_2111 (galU)
   00500 Starch and sucrose metabolism
    PST_2111 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    PST_2111 (galU)
Enzymes [BR:psa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PST_2111 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABP79776
UniProt: A4VLC5
Position
2290369..2291208
Genome map
AA seq 279 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALAAGLTQIAMVTGRGKR
SLEDHFDISYELEHQIRNTDKEKYLVGIRRLIDECSFSYTRQVEMKGLGHAILSGRPLIG
DEPFAVVLADDLCINLDGDPVLAQMVKLYNQFRCSIVAIQEVPPEETSKYGVIAGEMIRD
DIFRVSHMVEKPKPEDAPSNLAIIGRYILTPDIFDLIEQTEPGKGGEIQITDALMKQAQD
GCVLAYKFKGQRFDCGSAEGYIEATNFCYQNFYLTGKAF
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaaatgcctttttcctgctgccggatatggcacacgttttcttcctgcaacc
aaagccatgcccaaggaaatgctgccggtggtgaacaagcctctgatccagtacggggtc
gaggaagcgcttgctgcagggctcacgcagatcgccatggttaccggacgcggcaagcgc
tcgctggaagaccacttcgatatcagctatgaactcgaacatcagatccgcaacaccgac
aaggaaaaatacctggtcggtattcggcgcctgatcgacgagtgcagcttttcctatacc
cgccaggtggaaatgaaaggcctgggccatgccatcctcagcggccgcccgctgatcggt
gacgagccgttcgccgtggtgctggcggacgacctgtgcatcaacctggacggcgatccg
gtactggcacagatggtcaagctgtacaaccagttccgctgctccatcgtcgcgatccag
gaagtaccgccggaggaaaccagcaagtacggcgtgatcgccggtgaaatgatccgcgac
gatatcttccgcgtcagccacatggtggagaagcccaagccggaggatgctccgtcgaac
ctggcgatcattggtcgctacatcctgacgccggacatcttcgacctgatcgaacagacc
gaaccgggcaagggcggcgagatccagatcaccgatgcgttgatgaagcaggcgcaggat
ggctgcgtgctggcctacaaattcaaggggcagcgtttcgactgcggtagcgccgaggga
tacatcgaggcgaccaacttctgctaccagaacttctacctgaccggtaaggcgttctga

DBGET integrated database retrieval system