KEGG   Pseudomonas stutzeri A1501: PST_2302Help
Entry
PST_2302          CDS       T00511                                 

Gene name
idh
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
psa00020  Citrate cycle (TCA cycle)
psa00480  Glutathione metabolism
psa01100  Metabolic pathways
psa01110  Biosynthesis of secondary metabolites
psa01120  Microbial metabolism in diverse environments
psa01130  Biosynthesis of antibiotics
psa01200  Carbon metabolism
psa01210  2-Oxocarboxylic acid metabolism
psa01230  Biosynthesis of amino acids
Module
psa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:psa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PST_2302 (idh)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PST_2302 (idh)
Enzymes [BR:psa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     PST_2302 (idh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH HTH_15
Motif
Other DBs
NCBI-ProteinID: ABP79961
UniProt: A4VLW0
Position
2512659..2514887
Genome map
AA seq 742 aa AA seqDB search
MSTPSKIIYTFTDEAPALATYSLLPIVEAFAASADISVETRDISLAGRILASFADQLDAD
KKVEDDLAKLAELTNQPDANIIKLPNISASVPQLKAAIAELQALGYNIPNYPEDPQTDAE
KDARARYSKVLGSAVNPVLREGNSDRRAPAAVKAYARKHPHSMGKWSKASQSHADYMRGG
DFFSSEQSITMEKAGDVRIEFVGKDGKVEVKKQLALQEGEVLDGMFMSCKKLRAFFEDTL
QDCKETGVMWSLHVKATMMKISHPIVFGHAVSVYYKDVFDKYGDLFKELGVNPNNGISSV
YDKIKSLPASQQEEILHDIHEVYSHRPEMAMVDSVKGITNLHIPSDVIVDASMPAMIRNS
GQMWGKDGKQKDTKAVMPESTYARIYQEMINFCKTNGAFDPVTMGSVPNVGLMAQKAEEY
GSHDKTFEMHADGTMRVVLADGTVLMQHEVEKGDIWRACQTKDAPIRDWVKLAVTRARQS
NTPAVFWLDPERAHDMQLQKKVETYLQEHDLSGLDIRIMGYNEAIRLSMERMIRGKDTIS
VTGNVLRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEENYLR
WDSLGEFLALAVSLEETGIKTGNSKAKILGKTLDQATGKLLDNNKSPARKVGQIDNRGSH
FYLALYWAQALAAQDEDAELKAHFTPLAKTLTEQEAAIVAELAAVQGKPVDIGGYYRSNP
ELTSKVMRPSATFNAALAALNA
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccccttcgaagatcatctataccttcaccgacgaagctccagccctggcaacc
tattcgcttcttcccattgtagaagccttcgcagcctccgctgacatctccgtcgaaaca
cgcgacatctctcttgcagggcgcatccttgcgagcttcgccgatcagctggatgccgac
aagaaagtcgaagatgatctggccaagcttgccgagctgaccaaccagcccgacgccaac
atcatcaagctccccaacatcagcgcctccgttccacagctcaaggcagcgatcgccgag
ctgcaggccctgggctacaacatccccaactaccccgaagacccgcagaccgatgccgag
aaagacgcgcgcgcgcgttacagcaaggtgctcggtagcgccgtgaacccggtcctgcgc
gaaggcaactccgaccgccgcgcgccggccgccgtgaaagcctatgcccgcaagcatccg
cactccatgggtaagtggagcaaggcatcccagtcccacgccgattacatgcgcggcggc
gacttcttctccagcgaacagtcgatcaccatggaaaaagccggtgacgtgcgtatcgag
ttcgttggcaaggatggcaaggtcgaggtcaagaagcagctcgccctgcaggaaggcgaa
gtgctcgatggcatgttcatgagctgcaagaagctgcgcgcgttcttcgaagacacgctg
caggactgcaaggaaaccggcgtcatgtggtccctgcacgtcaaggcgaccatgatgaag
atctcccacccgatcgtcttcggccatgccgtgagcgtttactacaaggacgtcttcgac
aagtacggcgatctgttcaaggagctgggcgtcaacccgaacaacggcatcagcagcgtc
tacgacaagatcaagtccctgcccgcctcgcagcaggaagaaatcctgcatgacatccac
gaggtctatagccaccgcccggaaatggcgatggtcgactcggtcaagggcatcaccaac
ctgcacatcccgagcgacgtgatcgtcgacgcctcgatgccggcgatgattcgcaactcc
ggccagatgtggggcaaggatggcaagcagaaggacaccaaggcggtgatgccggagagc
acctacgcccgcatctaccaggaaatgatcaacttctgcaaaaccaacggcgccttcgac
ccggtcaccatgggcagcgtgccaaacgtcggtctgatggcgcagaaggctgaggaatac
ggctcacacgacaagaccttcgaaatgcacgccgacggcaccatgcgcgtcgtactggcc
gatggcaccgtactgatgcagcacgaagtcgagaaaggcgatatctggcgtgcctgccag
accaaggacgcgccgatccgcgactgggtcaagctggccgttacccgcgcccgccagtcc
aacaccccagccgtgttctggctggacccggagcgtgcccacgacatgcagctgcagaag
aaggtcgaaacctatctgcaggagcacgacctgagcggcctggacattcgcatcatgggc
tacaacgaagccattcgcctgagcatggagcgcatgatccgcggcaaggacaccatttcc
gtcaccggcaacgtgctgcgcgattacctgaccgacctgttcccgatcatggagctgggc
acctcggccaagatgctgtccatcgttccgctgatggccggcggcggcatgtacgagact
ggcgccggtggttccgcgccgaagcacgtgcagcagctggtcgaagagaactatctgcgc
tgggattcgctgggcgagttcctcgccctggcggtttcgctggaggagactggcatcaag
actggcaacagcaaggcgaagatcctcggcaagaccttggaccaggccactggcaagttg
ctggacaacaacaagtccccggcgcgcaaggttggccagatcgacaaccgcggcagccac
ttctacctggcgctgtactgggcgcaggctctggccgcgcaggacgaagatgccgagctg
aaggctcacttcactccgctggccaagaccctgaccgagcaggaagcggccatcgtcgct
gaactggcagccgtgcagggcaagccggtcgacatcggcggctactaccgctccaacccg
gagctgaccagcaaggtgatgcgccccagcgccaccttcaacgctgccctggccgcgctg
aacgcctga

DBGET integrated database retrieval system