KEGG   Pseudomonas stutzeri A1501: PST_2691Help
Entry
PST_2691          CDS       T00511                                 

Gene name
rrmA
Definition
(GenBank) rRNA methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
psa  Pseudomonas stutzeri A1501
Brite
KEGG Orthology (KO) [BR:psa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:psa03009]
    PST_2691 (rrmA)
Enzymes [BR:psa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     PST_2691 (rrmA)
Ribosome biogenesis [BR:psa03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    PST_2691 (rrmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_23 Methyltransf_12 MTS Methyltransf_32 Methyltransf_4 Ubie_methyltran Methyltransf_18 Methyltransf_33 Methyltransf_2 NodS PCMT MetW
Motif
Other DBs
NCBI-ProteinID: ABP80341
UniProt: A4VMZ0
Position
2916444..2917199
Genome map
AA seq 251 aa AA seqDB search
MACPANHRFDRARQGYLNLLPVQHKNSRDPGDNQAMVEARRRFLDGGHYAPLARRLAELA
AERAPQRWLDIGCGEGYYTAQLAAALPDAEGYALDISREAIKRACKRAPQLEWLVASMAR
VPLADASCDLLASVFSPLDWQEARRLLPPGGGLLRMGPTREHLWELRARLYDEVRDYDDE
KHLSLIPDGMRLTHSETLSYELQLDDAQARADLLAMTPHGWRASAERRAAVIDTPLAVRV
AIRYDWIERIS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtggcctgcccggccaaccaccgtttcgaccgcgcgcgccagggctacctgaacctgctg
cccgtgcagcacaagaacagccgcgatccgggcgacaaccaggcgatggtcgaggcgcgc
cggcgctttctcgatggcggtcactatgcgccgctggcccgacgcctcgccgagctggcc
gccgagcgcgcgccgcaacgctggctggacatcggctgtggcgagggctactacacagcc
caactggccgccgcgctgccggatgcagaaggctacgcactggacatctcccgcgaggcg
atcaagcgcgcctgcaaacgcgccccgcaactcgagtggctggtggcgagcatggcccgc
gtgccgctggccgatgccagctgcgacctgctggccagcgtgttcagcccgctggactgg
caggaagcgcgacgcctgctcccgcccggcggcggactgctgcgcatggggccgacccgc
gagcacctctgggagctgcgcgcgcggctctacgacgaggtacgcgactacgacgacgag
aagcacctgtcgctcattccggacggcatgcgcctgacccacagcgaaaccctcagctat
gaactgcagctggacgacgcccaggcccgcgccgacctcctggcgatgaccccgcacggc
tggcgcgccagcgccgagcggcgcgccgccgtcatcgacacgccgctggcggtgcgggtt
gcgatacgctacgactggatcgaacgaatttcctaa

DBGET integrated database retrieval system