KEGG   Pseudomonas stutzeri A1501: PST_3220Help
Entry
PST_3220          CDS       T00511                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
psa00071  Fatty acid degradation
psa00072  Synthesis and degradation of ketone bodies
psa00280  Valine, leucine and isoleucine degradation
psa00310  Lysine degradation
psa00362  Benzoate degradation
psa00380  Tryptophan metabolism
psa00620  Pyruvate metabolism
psa00630  Glyoxylate and dicarboxylate metabolism
psa00640  Propanoate metabolism
psa00650  Butanoate metabolism
psa00900  Terpenoid backbone biosynthesis
psa01100  Metabolic pathways
psa01110  Biosynthesis of secondary metabolites
psa01120  Microbial metabolism in diverse environments
psa01130  Biosynthesis of antibiotics
psa01200  Carbon metabolism
psa01212  Fatty acid metabolism
psa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PST_3220
   00630 Glyoxylate and dicarboxylate metabolism
    PST_3220
   00640 Propanoate metabolism
    PST_3220
   00650 Butanoate metabolism
    PST_3220
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PST_3220
   00072 Synthesis and degradation of ketone bodies
    PST_3220
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PST_3220
   00310 Lysine degradation
    PST_3220
   00380 Tryptophan metabolism
    PST_3220
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PST_3220
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PST_3220
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PST_3220
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psa04147]
    PST_3220
Enzymes [BR:psa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PST_3220
Exosome [BR:psa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PST_3220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ABP80856
UniProt: A4VPF5
Position
3476588..3477769
Genome map
AA seq 393 aa AA seqDB search
MQDVVIVAATRTAIGSFQGSLANVPAVELGATVIRALLEKTGIDPTQVDEVILGQVLTAG
AGQNTARQASIKAGLPHAVPSMTLNKVCGSGLKAVHLAVQAIRCGDAEVVIAGGMENMSL
APYVLPGARTGLRMGHAQIVDTMITDGLWDAFNDYHMGITAENLADKYGIDRAQQDAFAA
QSQQRAAAAIESGRFDAEITPVMIPQRKGDPVAFARDEQPRAGTTAESLGGLRAAFKKDG
CVTAGNASTLNDGAAAVVLMSASKAEALGLPVLAKIAGYANAGVDPAIMGIGPVTATRRC
LEKAGWTLAELDLIEANEAFAVQALSVGKELGWDADKVNVNGGAIALGHPIGASGCRILV
TLLHEMQRRDARKGLATLCIGGGQGVALAVERP
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacgtcgtcatcgtagctgcaacccgcaccgccatcggcagtttccagggctcg
ctggccaatgtgccggcagtcgaactgggcgccaccgtgatccgcgctctgctggaaaag
accggcatcgacccgactcaggtcgatgaagtcatcctcggccaggtgctcaccgccggc
gccgggcagaacaccgcgcgccaggcctcgatcaaggccggcctgccccacgccgttccg
tccatgacgctgaacaaggtctgcggctcgggcctcaaggccgtgcatctggccgtgcag
gcgatccgctgcggcgatgccgaagtggtcatcgccggcggcatggagaacatgagcctg
gcgccctacgttctgcccggcgcacgcaccggcctgcgcatgggccacgcgcagatcgtc
gataccatgatcaccgacggcctgtgggacgccttcaacgactaccacatgggcatcacc
gcggagaacctggccgacaagtacggcatcgaccgcgcccagcaggacgccttcgccgca
cagtcgcagcagcgtgccgcggcggccatcgaaagcggccgcttcgatgccgagatcacc
ccggtcatgattccccagcgcaagggcgacccggtcgccttcgcccgtgacgagcagccg
cgcgccggcaccacggccgaatccctcggcggcctgcgtgcagccttcaagaaggacggc
tgcgtcaccgccggcaacgcctcgaccctcaacgacggcgccgccgcggtggtgctgatg
agcgccagcaaggccgaggccctgggcctgccggtgctggccaagatcgccggctacgcc
aacgccggcgtcgacccggcgatcatgggcatcggcccggtcaccgccacccgtcgctgc
ctggaaaaggccggctggacgctggccgagctggacctgatcgaagccaacgaagccttc
gccgtgcaggcgttgtcggtcggtaaggaattgggctgggatgccgataaggtcaacgtg
aacggcggggccatcgccctcggtcacccgatcggcgcctcgggctgccgcatcctggtg
accctgctgcacgagatgcagcgccgcgacgcgcgcaagggcctggcgacactgtgcatc
ggtggtggtcagggagtagccttggcagtcgaacgcccctga

DBGET integrated database retrieval system