KEGG   Pseudomonas stutzeri A1501: PST_3667Help
Entry
PST_3667          CDS       T00511                                 

Gene name
hflX
Definition
(GenBank) GTP-binding protein HflX
  KO
K03665  GTPase
Organism
psa  Pseudomonas stutzeri A1501
Brite
KEGG Orthology (KO) [BR:psa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:psa03009]
    PST_3667 (hflX)
Ribosome biogenesis [BR:psa03009]
 Prokaryotic Type
  GTPases
   PST_3667 (hflX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP-bdg_N GTP-bdg_M MMR_HSR1 FeoB_N RsgA_GTPase Arf ABC_tran Dynamin_N MMR_HSR1_Xtn ATP_bind_1 SRPRB AAA_23
Motif
Other DBs
NCBI-ProteinID: ABP81290
UniProt: A4VQN9
Position
complement(3962321..3963580)
Genome map
AA seq 419 aa AA seqDB search
MHLDGQDPAAREDPQEFQELARSAGAETVGFVNVSRHQPSAKFLIGSGKVEELHDLVKEG
EAELVIFNHTLTPSQERNLERALECRVLDRTGLILDIFAQRARTHEGKLQVELAQLEHMS
TRLVRGWTHLERQKGGIGLRGPGETQLETDRRLLRVRIRQIKQRLEKVRGQREQARRGRR
RADIPSVSLVGYTNAGKSTLFNALTESEVYAANQLFATLDPTLRRLELEDVGPVILADTV
GFIRHLPHKLVESFRATLEESSNADLLLHVIDAHEPERDQQIEQVLAVLGEIGANELPML
EVYNKLDLLEGIEPQIQRDADGKPQRVWVSARDGLGLDLLRQAVAELLGDDLFVGTLCLP
QRLGRLRAQFFELGAVQRETHDEEGGSLLEVRLPRVELNRLISREGLRVDEFIEQHTLQ
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
gtgcacctggacggccaggatcccgcggcgcgcgaggaccctcaggagttccaggagctg
gcgcgttcggcgggggcggaaacggttggcttcgtcaatgtttcccgccaccagccctcc
gccaagttcctgatcggcagcggcaaggtcgaggagctgcatgacctcgtcaaggaaggc
gaggccgagctggtgatcttcaatcacacgctgacccccagccaggagcgtaacctcgag
cgtgcgctcgaatgccgtgtgcttgatcgcaccggcctgattctggacatcttcgcccag
cgggcgcgtacccacgagggcaagctgcaggtcgaactggcgcagctcgaacacatgagc
acgcggctggtccgcggctggacccacctcgaacggcagaagggcggtatcggcctgcgg
gggccgggtgaaacccagctggagaccgaccgtcgcctgctgcgcgtgcgcatccggcag
atcaagcagcgtctggaaaaggtccgtggccagcgcgagcaggcccgtcgtggccggcgt
cgtgcggacattccttccgtgtcgctggtgggctacaccaacgccggcaaatccacgcta
ttcaatgctctgaccgaatccgaggtctacgccgccaatcagctgttcgccacgctcgat
cccacgctgcgccgcctcgagctcgaggatgtcgggccggtgatcctggccgacacggtg
ggcttcatccgtcatctgccgcacaagctggtggaatcgttccgggcgacgctggaagag
tccagcaacgccgacctcctgctgcacgtgatcgatgctcacgagcccgaacgtgatcag
cagatcgagcaggtgctcgcggtgcttggcgagatcggcgccaacgagctgccgatgctc
gaggtgtacaacaagctcgaccttctcgagggtatcgagccgcagatacagcgcgatgcc
gatggcaagccgcagcgcgtctgggtgtccgcccgtgacggtctggggctcgacctgctg
cgtcaggccgtcgccgagctgctcggtgatgatctcttcgtcggcacgttgtgcctgccg
cagaggctgggccgcttgcgtgcgcagttcttcgagctgggtgcggtgcagcgcgagacg
cacgacgaggagggtggaagcctgctggaagttcgcttgccgcgggtcgaactgaatcgc
ttgatcagccgcgaagggttgcgagtggacgagttcatcgagcaacacactttgcaataa

DBGET integrated database retrieval system