KEGG   Pseudomonas stutzeri A1501: PST_3853Help
Entry
PST_3853          CDS       T00511                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
psa00010  Glycolysis / Gluconeogenesis
psa00020  Citrate cycle (TCA cycle)
psa00620  Pyruvate metabolism
psa01100  Metabolic pathways
psa01110  Biosynthesis of secondary metabolites
psa01120  Microbial metabolism in diverse environments
psa01130  Biosynthesis of antibiotics
psa01200  Carbon metabolism
Module
psa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PST_3853 (aceF)
   00020 Citrate cycle (TCA cycle)
    PST_3853 (aceF)
   00620 Pyruvate metabolism
    PST_3853 (aceF)
Enzymes [BR:psa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PST_3853 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H PYNP_C RnfC_N HlyD_D23 HlyD_3 CAT
Motif
Other DBs
NCBI-ProteinID: ABP81476
UniProt: A4VR75
Position
4171663..4173327
Genome map
AA seq 554 aa AA seqDB search
MSETIRVPDIGSGEGEVIELFVKVGDRIEADQSILTLESDKASMEIPAPKAGVVKALKVK
LGDRLKEGDELLELESEGGEAAAEAPAAPAAEAAQPSQAPDEAEATEAPAASEAPAAAGA
EQSQEIRVPDIGSAGKANVIEIMVKAGDSVQAEQSLITLESDKASMEIPSPVAGVVESLA
IKLNDEVGTGDLILTLKVQGAAPAKQAESTPAPSPAEPAKAASPEQADRKPAPTAQSEAP
QAVGAPSRDGAKVHAGPAVRQLAREFGVELSAVAGSGPKGRILKEDVQQYVKTMLQQGNA
EPTAAAAGGAGIPPIPAVDFSKFGEVEEVAMSRLMQIGAANLHRSWLNVPHVTQFESADI
TELEAFRVAQKAIAEKAGVKLTVLPLLLKACAHLLKELPDFNSSLAPSGKALIRKKYVHV
GFAVDTPDGLMVPVIRNVDQKSLLQLAGEAAELAEKARTKKLSPDAMQGACFTISSLGHI
GGTGFTPIVNAPEVAILGVSKAAMQPVWDGKAFQPRLMLPLSLSYDHRVINGAAAARFTK
RLSELLADIRTMLL
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaaaccatacgcgtacccgacatcggcagcggtgagggtgaagtgatcgagttg
ttcgtcaaggtcggcgaccgtatcgaagccgaccagagcatcctgacgctcgagtccgac
aaggccagcatggaaatcccggcgcccaaggcaggcgtcgtgaaagccttgaaggtcaag
ctgggcgatcgcctgaaggaaggcgacgaactgctggagctggaaagcgaaggtggcgaa
gccgctgccgaagcacccgcggcgcctgccgcggaggccgcgcaaccgagccaggcgccc
gatgaagccgaagccactgaagcccctgcggccagcgaagcaccggccgcagcaggcgcc
gaacagagccaggagatccgcgtgccggatatcggctcggccggcaaggccaacgtcatc
gagatcatggtcaaggcgggtgattcggtacaggccgagcagtcgctgatcaccctggaa
tcggacaaggccagcatggagattccgtctccagtggccggcgtggtagagagcctggcg
atcaagctgaacgacgaggtcggcaccggtgatctgatcctgaccctcaaggtccagggc
gcggcaccggccaagcaggccgagtcgacgccggcgccgagtcccgccgagccggccaag
gccgcaagcccagaacaagccgaccgcaagccggcaccaaccgcgcagagcgaagctcca
caggcggtcggcgcaccgagccgcgacggcgccaaggtgcatgccggcccggccgtgcgc
cagctggcccgcgagttcggcgtcgagctgagcgcggtcgccggcagcggtccgaaggga
cgcatcctcaaggaagacgtgcagcagtatgtgaagaccatgctgcagcagggcaatgcc
gaaccgaccgcggccgcggccggtggagccggcattccgccgatcccggcggtggacttc
agcaagttcggcgaggtcgaggaagtcgcgatgtcgcgactgatgcagatcggcgccgcc
aacctgcatcgcagctggctgaacgtgccgcacgtgacccagttcgagtcggccgacatt
accgagctggaagctttccgcgttgcgcagaaggcgatcgccgagaaggctggggtcaag
ctcaccgtgctgccgctattgctcaaggcgtgcgcgcacctgctaaaggaactgccggat
ttcaacagttccctggccccgagcggcaaggcgctgatccgcaagaagtatgtgcacgta
gggttcgccgtcgacacgccggatggcctgatggtcccggtgattcgcaacgtcgaccag
aagagtctgctgcaactggccggcgaggctgcggagctggctgagaaggcccgcaccaag
aagctttctccggatgcgatgcagggcgcctgcttcacgatctccagcctcggccacatc
ggcggcaccggcttcacgccgatcgtcaatgcgccggaagtggcgatcctaggcgtctcc
aaggcggccatgcagccggtgtgggatggcaaggccttccagccccgcctgatgctgccg
ctgtcgctctcctacgaccaccgggtgatcaacggtgccgcggcggcgcgcttcaccaag
cgcctgtcggagctgctggccgatatccgcaccatgctgctgtaa

DBGET integrated database retrieval system