KEGG   Pseudomonas stutzeri A1501: PST_3898Help
Entry
PST_3898          CDS       T00511                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
psa  Pseudomonas stutzeri A1501
Pathway
psa00620  Pyruvate metabolism
psa00630  Glyoxylate and dicarboxylate metabolism
psa01100  Metabolic pathways
psa01110  Biosynthesis of secondary metabolites
psa01120  Microbial metabolism in diverse environments
psa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PST_3898
   00630 Glyoxylate and dicarboxylate metabolism
    PST_3898
Enzymes [BR:psa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PST_3898
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ABP81521
UniProt: A4VRC0
Position
4225614..4227794
Genome map
AA seq 726 aa AA seqDB search
MTERVQVGGLQVAKVLYDFVNNEAIPGTGVDAAAFWAGADSVIHDLAPKNRALLAKRDEL
QAKIDAWHQARAGQAHDAVAYKAFLQEIGYLLPEAEDFQATTENVDEEIARMAGPQLVVP
IMNARFALNAANARWGSLYDALYGTDAISEADGATKGPGYNEIRGNKVIAYARNFLNEAA
PLETGSHVDSTGYRIEGGKLVVSLKDGSTTGLKNPAQLQGFQGDASAPIAVLLKNNGIHF
EIQIDPASPIGQTDAAGVKDILMESALTTIMDCEDSIAAVDADDKTIVYRNWLGLMKGDL
VEELDKGGKRITRAMNPDRVYTKADGNGELTLHGRSLLFIRNVGHLMTNDAILDKAGNEV
PEGIMDGLFTSLIAIHNLKGNTTRANSRTGSMYIVKPKMHGPEEVAFATELFGRVEDVLG
LPRNTLKVGIMDEERRTTINLKACIKEARERVVFINTGFLDRTGDEIHTSMEAGPMVRKA
AMKSEKWISAYENNNVDVGLACGLQGKAQIGKGMWAMPDLMAAMLEQKVGHPLAGANTAW
VPSPTAATLHAMHYHKIDVQARQAELAKREKASIDDILTIPLAQNTNWSEEEKRNELDNN
SQGILGYMVRWVEQGVGCSKVPDINDIALMEDRATLRISSQHVANWMRHGVVTKDQVIES
LKRMAPVVDRQNQGDPLYRPMAPDFDNSVAFQAALELVLEGTKQPNGYTEPVLHRRRREF
KAKNGL
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcgcgttcaagtcggtggcctgcaggtcgccaaagtcctgtacgacttcgtg
aacaacgaggcgattcccggtaccggcgtcgatgccgccgccttctgggctggcgccgac
agcgtgatccacgacctggcgccgaagaaccgcgccctgctggccaagcgcgacgagctg
caggccaagatcgacgcctggcaccaggcccgcgccggccaggcccatgacgccgtggcg
tacaaggccttccttcaggaaatcggctacctgctgccggaagccgaagacttccaggcc
accaccgagaacgtcgacgaagaaatcgcccgcatggccggcccgcagctggtggtgccg
atcatgaacgcgcgcttcgccctgaacgccgccaacgcccgctggggctcgctgtatgac
gcgctctacggcaccgacgccatctccgaagcggacggcgccaccaaggggccgggctac
aacgagatccgcggcaacaaggtcatcgcctatgcgcgcaatttcctcaacgaagctgca
ccgctggaaaccggctcgcacgtcgattccaccggctatcgcatcgaaggcggcaagctg
gtcgtttcgctgaaggatggcagcaccaccggcctgaagaacccggcccagctgcagggc
ttccagggcgacgccagcgcaccgatcgccgtgctgctgaagaacaacggcatccacttc
gagatccagatcgacccggccagcccgatcggccagaccgatgccgccggcgtgaaggac
atcctgatggaatcggcactgaccaccatcatggactgcgaagactccatcgccgccgtc
gacgccgacgacaagaccatcgtctaccgcaactggctcggcctgatgaagggcgatctg
gtcgaggagctggacaagggcggcaagcgcatcacccgcgccatgaacccggaccgcgtc
tacaccaaggccgacggcaacggcgagctgaccctgcacggacgctcgctgctgttcatc
cgcaacgtcggtcacctgatgaccaacgacgccatcctcgacaaggcaggcaacgaagtg
ccggaaggcatcatggacggcctgttcaccagcctgatcgccatccacaacctcaagggc
aacaccacccgcgccaacagccgcaccggctcgatgtacatcgtcaagccgaagatgcac
ggcccggaagaagtcgccttcgccaccgagctgttcggccgcgtcgaggacgttctcggc
ctgccgcgcaacaccctcaaggtcggcatcatggatgaggagcgtcgtaccacgatcaac
ctcaaggcctgcatcaaggaagcgcgcgagcgcgtggtgttcatcaacaccggcttcctc
gaccgcaccggcgacgaaatccatacctccatggaagccggcccgatggtgcgcaaggcg
gccatgaagtccgagaaatggatcagcgcctacgagaacaacaacgtggacgtgggcctg
gcctgcggcctgcagggcaaggcgcagatcggcaagggcatgtgggccatgcctgacctg
atggccgccatgctcgagcagaaggtcggccatccgctggccggcgccaacaccgcgtgg
gtaccgtcgccgaccgcagccaccctgcacgcgatgcactaccacaagatcgacgtgcag
gcgcgccaggccgaactggccaagcgcgagaaggcttcgatcgatgacatcctcaccatc
ccgctggcacagaacaccaactggagcgaggaagagaagcgcaacgagctggacaacaac
tcgcagggcatcctcggctacatggtgcgctgggtcgaacagggcgttggttgctccaag
gtgccggacatcaacgacatcgcgctgatggaagaccgtgccaccctgcgcatctccagc
cagcacgtggccaactggatgcgccacggcgtggtaaccaaggaccaggtgatcgagagc
ctcaagcgcatggccccggtggtcgaccgccagaaccagggtgacccgctgtaccgcccg
atggcgcctgacttcgacaacagcgtggccttccaggctgcgctggagctggtcctcgaa
ggcaccaagcagcccaacggctacaccgagccggtcctgcaccgtcgccgccgcgagttc
aaggccaagaacggcctgtaa

DBGET integrated database retrieval system