KEGG   Paenibacillus sabinae: PSAB_03705Help
Entry
PSAB_03705        CDS       T03064                                 

Definition
(GenBank) hypothetical protein
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
psab  Paenibacillus sabinae
Brite
KEGG Orthology (KO) [BR:psab00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PSAB_03705
Enzymes [BR:psab01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     PSAB_03705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AHV95677
UniProt: X4ZDX2
Position
834910..835728
Genome map
AA seq 272 aa AA seqDB search
MKFRVVMAQLESTSDKQVNYEKAAKAVREAACSHFAQMVVFPEIFMSFFPAHTPKYIIVD
DAETLEGPFVTGMRKLAAEYGVWLIFGMKELTDEHKADRVYNTVVIVDSGGSIAGSYRKT
HLYDAFGLKESDTIMPGDRLFEPIQTPFGKLGLFVCYELRFPEIARYQAARGAEIIIVPS
GWVRGPMKEQHWSHLITVRALENTVFMVACNQVSDFYSGQSLVADPMGVLMAAGPENEAL
IACELDLSRIGSVRSKLPSYEQRRPELYSSLI
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatttcgagtagtcatggcgcagctggaatcgacatcggacaagcaagtgaactat
gaaaaagcggcaaaggcagtccgggaagccgcttgcagccacttcgcccaaatggttgtt
tttcccgaaatatttatgagctttttccccgcacacactccaaagtatatcatcgtggat
gacgccgagacactggagggtccgtttgtcaccggcatgaggaagctggcggccgagtat
ggcgtatggctgatattcggaatgaaggaattgacggatgagcataaggcggaccgggtg
tacaacacggtagtcattgttgatagcggcggctcgatcgccggatcgtaccggaagact
catctgtatgacgctttcgggctgaaggaatccgacacgatcatgcccggcgaccgtctc
ttcgagccgattcagaccccatttggcaagctcggattgttcgtctgttatgagcttcgc
ttccccgagattgcccgctatcaggcggcccggggagcggaaatcattattgtcccttcc
ggctgggtccgcgggccgatgaaggagcagcattggagccacttgatcacggttcgggca
ttggaaaatacggtgttcatggttgcctgtaaccaggtgagcgatttctacagcggacaa
agccttgtcgccgatccgatgggcgtcctgatggccgccggaccggagaacgaagcgctg
atcgcttgtgaactcgatctttcccgaatcggaagcgtacgttccaagctgccatcgtat
gaacagcgaagacccgagctgtattcatcactgatttga

DBGET integrated database retrieval system