KEGG   Paenibacillus sabinae: PSAB_15515Help
Entry
PSAB_15515        CDS       T03064                                 

Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
psab  Paenibacillus sabinae
Pathway
psab00561  Glycerolipid metabolism
psab00640  Propanoate metabolism
psab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    PSAB_15515
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    PSAB_15515
Enzymes [BR:psab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     PSAB_15515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase AIRC NAD_kinase TMEM237
Motif
Other DBs
NCBI-ProteinID: AHV98010
UniProt: X4ZN28
Position
complement(3381553..3382755)
Genome map
AA seq 400 aa AA seqDB search
MTDQPEAKPIFIQGETRAAGFFVGKIRRSGFMITLKAPKTYIREKNILDSAGPLIAEIGQ
NALIIGGNTALALTGKHLLPSLDDVGVHYHVHTFEGECTAAAITRYARLVRETGADCVIG
IGGGRVLDLAKAAAEDGGVPVISVPTIAATCAAWSALTIIYDEEGRYAFPRPLQESPLLV
LADTAVLASAPARYLKAGIADTIVKWHEAEPNAAGRPDLSLSIGLSVSRLALDLLDEQAV
EASQAAGSGAITPAFAETVDAVIALAGLAGSITQGNPRVALAHSIHNSLTFLPATHGSLH
GEKVIFGLIVQFVLAGKTLQEINELISFLCELTLPVTLEQLGIGGDISVQAAKIAESVDI
DPEARERLAFEVSVPLLKEAILAADRYGREILASRAVSIS
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
ttgacggatcaaccggaagccaagccgatattcattcaaggggaaacccgggcggctggc
ttttttgttggcaaaatcaggaggagcgggtttatgataacgttgaaagccccgaagacc
tatattcgcgagaagaacattctcgattcggcaggtccgctaattgccgaaattggccaa
aacgctctcattatcggcggaaatacggcgcttgcgctgacaggcaagcacttgctgcca
agccttgacgacgtgggcgtacattatcacgtgcatacgtttgagggtgaatgtaccgcc
gcagcaatcacccgctatgcccgtctcgtacgcgagactggtgccgattgcgttatcggc
atcggcggcggccgggtgctcgatttggcgaaggcggccgccgaggacggcggtgttccc
gtcattagcgttccgacgattgccgccacctgcgcagcctggtccgcactgacgattatt
tacgatgaagaaggaagatatgcgtttccgcgtccgcttcaggaatccccgctgcttgtt
ctggcggatacggccgttctcgcttctgcccccgcccgttacctgaaggcaggcatcgcc
gatacgatcgttaaatggcatgaagcggagcctaatgccgctggccggcccgatctgtca
ctcagcatcggcttaagcgtatcgcggcttgcgctcgatcttcttgatgaacaggcggtg
gaggcctctcaggcagcgggcagcggcgctattacaccagcatttgccgagaccgtggat
gccgtaattgcactggccggtcttgcgggcagcattacgcaaggaaatccacgggtggcg
ttggcccattcgattcataacagtctgacctttcttcctgcaacccacggcagccttcat
ggagaaaaggttatcttcggcttaatcgtccagtttgtacttgcgggcaagactttacag
gaaatcaacgagctgatttcatttctgtgtgagcttacgcttcccgtcactctggagcag
ctaggtattggcggcgacatttccgttcaggcggccaaaatcgctgagagtgtggatatt
gatcccgaagcccgggagcggctggcgtttgaagtgagcgttccgcttctgaaggaagcc
attcttgcagccgaccgttacggccgtgagattctggccagcagagcggtcagtattagt
taa

DBGET integrated database retrieval system