KEGG   Paenibacillus sabinae: PSAB_20275Help
Entry
PSAB_20275        CDS       T03064                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
psab  Paenibacillus sabinae
Pathway
psab00030  Pentose phosphate pathway
psab00480  Glutathione metabolism
psab01100  Metabolic pathways
psab01110  Biosynthesis of secondary metabolites
psab01120  Microbial metabolism in diverse environments
psab01130  Biosynthesis of antibiotics
psab01200  Carbon metabolism
Module
psab_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
psab_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:psab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PSAB_20275
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PSAB_20275
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psab04147]
    PSAB_20275
Enzymes [BR:psab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     PSAB_20275
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     PSAB_20275
Exosome [BR:psab04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   PSAB_20275
  Exosomal proteins of colorectal cancer cells
   PSAB_20275
  Exosomal proteins of bladder cancer cells
   PSAB_20275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AHV98946
UniProt: X4ZHG2
Position
complement(4420289..4421842)
Genome map
AA seq 517 aa AA seqDB search
MAENQTFDELKTPGAVFFIFGATGDLARRKLFPAIYSLYREGKLAEDFAVIGVARRPRSP
EEFREDVKASIREFSRYQAIDDNEWTGFVNHFEYKSLDINNIDGFRELREQTEGLEERFR
IPGNRLFYLALAPELFGSVSFNLKAGGMLDGEGWNRLVIEKPFGYDLESAEKLNEQIRQV
FQEEEIFRIDHYLGKEMVQNIEVIRFANAFFEPLWNKQHIANIQITLGETVGVEERGGYY
DHAGALRDMAQNHMLQLLTMIAMEPPSRLLAEDIRDEKVKVLRSLRPYLTGEEVRKNVVR
GQYTQGLFNGKTLPAYRQEDKVNPESTTETYFAARVFVDNFRWAGVPFYIRTGKRLPAKT
TEVVVEFKSMPTNVYLGQKHNLEPNLLVIRVNPMEGIYVKINAKKPGSESEIQPLAMDFC
QSCLIGINSPEAYERLLHDAARGDSTYFTRWDEVSSAWSFVDHIAKAWREDSSDLASYPA
GTWGPVEAAELLEQDGFQWWPVNGQKESNVVWSVNNN
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaatcaaacctttgatgaattgaaaacacccggcgctgtattttttattttt
ggtgcaaccggcgacttggcccggcgcaagctttttccggccatttacagcctgtaccgt
gaagggaagcttgccgaggattttgcggtaatcggcgtggcacgccgtccacggagtccc
gaggagttcagggaagatgtgaaggcctcgatccgcgagttcagccgttatcaagccatt
gatgacaatgaatggacaggattcgtcaatcattttgagtataaatcgctcgatattaac
aatattgatggtttccgcgagttgagagagcagaccgaagggctggaggagcggttccgc
attccgggcaaccgcctgttctacctggcgctcgctcccgagctgttcggaagcgtatcg
ttcaacctgaaagccggaggcatgctggatggagaaggctggaatcgtctcgttattgaa
aagccgttcggttacgatctggagtcggccgagaagctgaacgagcagatccgccaagtc
ttccaggaagaagaaatcttccggatcgaccattatctcggcaaggaaatggtacagaat
atcgaagtgatccgcttcgccaacgccttctttgagccgctgtggaacaagcagcacatc
gccaacatccagattacgctgggtgaaaccgtcggtgtcgaagagcgcggcggctattac
gaccatgccggagcgctgcgggatatggcccagaaccatatgcttcagctgctgaccatg
atcgcgatggagccgccaagccgtctgcttgcggaggatatccgcgatgagaaggtcaag
gtgctgcgctcgctccgtccatatttgaccggcgaagaagtgcgcaagaacgtggttcgc
gggcagtatacgcaggggctgttcaacggcaagaccctgccggcttaccgccaggaagac
aaggtgaatccggagtcaacgacggaaacgtattttgccgcccgggtattcgtggataac
ttccgctgggcgggcgtaccgttctacatccgcacaggcaaacgcctgccggccaagacg
accgaggtggttgtggagttcaagagcatgcctaccaatgtctatttggggcagaagcat
aacctggaaccgaatctgctcgttatccgcgttaacccgatggaaggcatttacgtgaag
atcaatgccaagaagccgggctcggaatcggagattcagccgctggcgatggacttctgc
cagagctgtctgatcggcatcaactcgccggaagcctatgagcgtctgctgcatgatgcg
gcgcggggcgattccacctacttcacccgttgggatgaggtatcctcggcatggtcgttc
gtggaccatatcgccaaagcctggagagaggattccagcgatctggcttcctatccggca
ggcacctggggaccggttgaagcggctgagctgcttgaacaggacggcttccagtggtgg
ccggtcaacggacagaaggaaagtaatgttgtatggtcagtgaacaataattaa

DBGET integrated database retrieval system