KEGG   Paenibacillus sabinae: PSAB_21345Help
Entry
PSAB_21345        CDS       T03064                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
psab  Paenibacillus sabinae
Pathway
psab00260  Glycine, serine and threonine metabolism
psab01100  Metabolic pathways
psab01110  Biosynthesis of secondary metabolites
psab01120  Microbial metabolism in diverse environments
psab01130  Biosynthesis of antibiotics
psab01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:psab00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSAB_21345
Enzymes [BR:psab01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     PSAB_21345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_4_9
Motif
Other DBs
NCBI-ProteinID: AHV99158
UniProt: X5A4E5
Position
complement(4639070..4639579)
Genome map
AA seq 169 aa AA seqDB search
MAPGGGNLSSDLSLADIARLCDVFYIGGTKIGALFGEAAVILNDELKKDFRYMIKQKGGL
LAKGRLLGIQFETLFEDGLYYEISSHAVEMAMMIREAFVEKGFSLRYDSKTNQQFPILPE
DVLMKLGTKYSFSFWEKADTNHSVVRFCTSWATKKENVEMLIKDIKELE
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
ttggctccgggtggcggcaatttatctagcgatttatccttggcggatattgcaagactt
tgtgatgtgttctatatcgggggaactaagatcggagcgttatttggggaagcagcagtg
atcctaaatgatgagctgaaaaaagattttcggtatatgatcaagcaaaagggaggatta
ctggccaaggggagattactcggaatccagtttgaaaccttgtttgaagatggcttgtac
tatgaaatttccagtcatgccgtagaaatggcgatgatgattcgagaggcttttgttgaa
aaaggcttttcattacgatatgattccaaaaccaatcaacagtttcccattttgccggaa
gatgtgttgatgaaattgggcacaaagtattctttttccttctgggaaaaagccgatact
aatcacagtgttgtgagattctgtaccagttgggctacaaaaaaagaaaatgttgaaatg
ctgattaaggatattaaggaattggaatag

DBGET integrated database retrieval system