KEGG   Paenibacillus sabinae: PSAB_21630Help
Entry
PSAB_21630        CDS       T03064                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
psab  Paenibacillus sabinae
Pathway
psab03010  Ribosome
Brite
KEGG Orthology (KO) [BR:psab00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    PSAB_21630 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:psab03011]
    PSAB_21630 (rplV)
Ribosome [BR:psab03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    PSAB_21630 (rplV)
  Bacteria
    PSAB_21630 (rplV)
  Archaea
    PSAB_21630 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AHV99215
UniProt: X4ZRX5
Position
complement(4689091..4689423)
Genome map
AA seq 110 aa AA seqDB search
MQAKAHARSVRISARKAKLVVDLIRGKQVGEAIAILRHTPKSASPVVEKLLNSAIANAEH
NYSLDVNKLFISEVFVNQGPTMKRFRPRAMGRASRINKRTSHITLVVSEK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcaaaagcgcatgcaagatcggtacggatttccgctcgtaaagcgaaactggtt
gttgacttgattcgcggcaagcaagtgggagaagcaatcgcaatccttcgccacactccg
aaatccgcttccccggtggttgaaaagctgctgaactcggcgatcgccaatgccgagcat
aactattcgctggacgtaaacaagctgttcattagcgaggttttcgttaaccaaggtcca
acgatgaaacggttccgtccgcgcgcgatgggtcgcgcaagccggatcaacaaacgcacc
agccacattactttggtggtatctgagaaataa

DBGET integrated database retrieval system