KEGG   Proteiniphilum saccharofermentans: PSM36_2188Help
Entry
PSM36_2188        CDS       T04672                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
psac  Proteiniphilum saccharofermentans
Pathway
psac00051  Fructose and mannose metabolism
psac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PSM36_2188
Enzymes [BR:psac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     PSM36_2188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N TrkA_N DUF1188 3HCDH_N ApbA Gp_dh_N NAD_Gly3P_dh_N AAA_9
Motif
Other DBs
NCBI-ProteinID: SCD20993
UniProt: A0A1R3SXK3
Position
I:complement(2725098..2726264)
Genome map
AA seq 388 aa AA seqDB search
MNERKIVIFGAGKIGRSFIGQVFNLSGYEVVFVDINKQLVDLINQQKQYRIVIKNGEEDE
LLIIRNIKGIYLDEEEQLMSELNNTKIMSLSVGQQGVGTVIPLLARLLVVRREKYGDVPL
DIIIAENIRNADRLIRKELEKQLPPDYPLEKLVGLVETSIGKMVPIMTQKDIEEDPLQVF
AESYNSLIVAKNGFKNPIPDIPFLAPKENIKAWVDRKLFIHNLGHAATAYLGFKKYPDAV
YICEVLEDQELLDTVRQTMLQSAEILRSLYPEEFTLTQLKEHIDDLICRFRNKSLKDTLF
RVGCDLYRKLGPEDRLAAPVHAAVRLGKPYHLILNAIIAGISFRAKDENGNYFPSDRLFF
EEAVRGPRYILENVCKIRWESGKVGRKN
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagagaaaaattgttatttttggagccgggaagattgggcgctcttttataggg
caggtattcaatttgtcagggtatgaagtcgtttttgtggatatcaataagcaattggtc
gatctgataaatcaacagaaacaataccggatagtcatcaaaaacggagaagaggatgag
ttgctgatcattcgtaatataaaaggtatataccttgatgaagaggaacaacttatgtcc
gagttgaataatacaaaaattatgtccctttccgtgggacaacagggagtaggcacagtg
attcctctgctggccaggttattagttgtccgacgggaaaaatatggagatgtacccctg
gatataattatagcagagaatataagaaacgcggataggcttatccggaaagaattggaa
aaacagttgccgccggattatccattggaaaaattggtgggattagtggaaacgagcatt
ggaaagatggtgcctatcatgacacaaaaggatatcgaggaggatccgttacaggtattt
gccgaatcttataactctttgatcgttgcaaaaaacggatttaaaaacccaattcccgat
attccttttctggcgcccaaagagaatatcaaagcctgggtcgaccgcaaactttttatc
cacaatttagggcatgctgcgacggcttatcttgggtttaaaaaatatccggatgccgtt
tatatctgtgaagtactcgaagatcaagaacttcttgataccgtgaggcaaacaatgctg
caatctgctgaaatcctacggtcattatatccggaagagtttaccctgacccagctgaaa
gaacatatagatgacctgatatgtcgattcagaaataaaagtttaaaagataccctgttt
cgtgtggggtgtgacctgtaccggaaactgggcccggaagaccgattggctgctcctgtc
catgctgctgtccggctgggaaaaccttatcacctgatcctgaatgcaattatcgcagga
atatctttcagggctaaagatgaaaacggtaattacttcccttcggacagattgttcttt
gaggaggcagtaagaggtccccggtatatattggagaatgtgtgtaagataaggtgggaa
agtgggaaggtgggaaggaaaaactaa

DBGET integrated database retrieval system