KEGG   Pontimonas salivibrio: C3B54_111462Help
Entry
C3B54_111462      CDS       T05334                                 

Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
psai  Pontimonas salivibrio
Pathway
psai00270  Cysteine and methionine metabolism
psai00920  Sulfur metabolism
psai01100  Metabolic pathways
psai01110  Biosynthesis of secondary metabolites
psai01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psai00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    C3B54_111462
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    C3B54_111462
Enzymes [BR:psai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     C3B54_111462
    2.3.1.46  homoserine O-succinyltransferase
     C3B54_111462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Esterase
Motif
Other DBs
NCBI-ProteinID: AVG24404
UniProt: A0A2L2BRU4
Position
1424963..1426171
Genome map
AA seq 402 aa AA seqDB search
MDWQLPSDSVPSAFVTEALSQTLRGTPPVTGAWRDGDHLGNRRFAQTGPLETETGDTIPH
VRIAYEIFGELDADKTNAVLVFHALTGDSHATGPAGPGHPTGGWWSGIIGPGLALDTDTF
AVIVPNIVGGCQGSTGPATVAPNGHEWGSRFPYLTVRDQIQPIRAIAEELGIHRFHAVIG
GSMGGMHALEWAIAYPDYTARLGLIATTAITSADQLGVNSVQIEAVHIDPAFHGGDYYDE
DEGPYRGLALARRMALLNYRSATELNERFERSWQGKRSPLGDSGRFAVESYLDFHGNKFT
RRFDANSYLTLVNAMNSHDVSRDRGSLEGVLGSIEMPTIVVGVDSDRLFPLEQQQQLAAH
IPGLISKDKRPAVVSSPFGHDGFLIESDAVGQEISRLLVHKA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggattggcagctcccctccgactctgtccccagtgctttcgtcactgaggcgctgtcg
caaacccttcggggcacgcctccggtcactggagcatggcgtgacggtgatcacctcggc
aatcgacgcttcgcacagactgggcccctggagaccgaaacgggggacaccattccccac
gtgcgcatcgcgtacgagatttttggtgagctcgacgccgacaagaccaatgcagtattg
gtctttcacgccctcaccggcgattcacacgccacaggtcccgcaggccccggacacccc
accggtggctggtggtcaggaatcatcgggcccggtctcgcattagatacggacaccttc
gcggtgattgtgccgaacatcgtgggcggctgccaaggctcgacaggacccgccacggtg
gcacccaatggccacgaatggggctctcgttttccttacctcacggtgagagaccaaatt
caacccattcgcgccatcgcggaggagctcggcattcatcgtttccacgcggtgattggc
ggctcgatgggcggtatgcacgccctggagtgggctattgcctaccccgattacacggct
cgcctcggtctcattgccaccacagcaatcaccagcgctgaccagttgggggtgaactct
gtccagatcgaagccgtccacatcgaccccgcgtttcacggcggcgactactacgacgaa
gatgagggcccctaccgcggattggctctggccagacggatggctctattgaactatcgc
tcagccaccgaattaaacgaacgctttgagcgcagttggcagggaaaacgctcaccgtta
ggtgactcgggccgctttgcggtggagagttacctcgactttcacggcaacaaattcacc
cgacgctttgatgcaaacagctacctcacgctggtcaatgcgatgaacagtcacgatgtc
agccgcgaccgcggctcactcgaaggcgtcttgggctccatcgaaatgccgaccattgtt
gtgggtgtcgactctgatcgactttttcccctcgaacagcaacaacaactcgctgcccac
attccgggactgatcagcaaagacaagcgcccagccgtcgtgtcgtccccatttggccat
gacggcttcttgatcgaatcggacgctgtcggccaggagattagccggttgctggtccac
aaggcgtaa

DBGET integrated database retrieval system