KEGG   Pontimonas salivibrio: C3B54_11318Help
Entry
C3B54_11318       CDS       T05334                                 

Definition
(GenBank) large subunit ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
psai  Pontimonas salivibrio
Pathway
psai03010  Ribosome
Brite
KEGG Orthology (KO) [BR:psai00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    C3B54_11318
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:psai03011]
    C3B54_11318
Ribosome [BR:psai03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    C3B54_11318
  Bacteria
    C3B54_11318
  Archaea
    C3B54_11318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AVG23316
UniProt: A0A2L2BNS2
Position
295324..295725
Genome map
AA seq 133 aa AA seqDB search
MVESMARVRQIRVTPQKARRVVNLIRGMRAVEAVAILKHQPQAVSEPLGKVVASAIANAQ
VIADRDGVFLDETDLYIAKAFVDEGITLKRFRPRAQGRAFRINKRTSHITVVLATPDEPS
LGSRAGAKQKVSK
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atggtggaatcgatggcccgggtgcgacaaattcgcgtcacaccccaaaaggcccgccga
gtcgtcaacctgattcgtggaatgcgcgcagtggaagctgtcgccattctcaagcaccag
ccacaagctgtcagtgagcccctcggcaaagttgttgcctcggcaattgctaacgcccag
gtaatcgctgatcgcgacggagtgttcttggacgaaaccgacctctacatcgccaaagcg
tttgtggacgagggaatcacgctgaagcgttttcgcccacgcgcccagggacgtgcgttt
cgtatcaacaagcgcaccagccacatcactgtggtcctggcaacccccgatgaaccgtcg
cttggctcacgagccggcgcgaagcagaaggtgagcaagtaa

DBGET integrated database retrieval system