KEGG   Piscirickettsia salmonis: PSLF89_1457Help
Entry
PSLF89_1457       CDS       T03982                                 

Definition
(GenBank) integrase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
psal  Piscirickettsia salmonis
Pathway
psal00250  Alanine, aspartate and glutamate metabolism
psal00330  Arginine and proline metabolism
psal01100  Metabolic pathways
psal01110  Biosynthesis of secondary metabolites
psal01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psal00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PSLF89_1457
   00330 Arginine and proline metabolism
    PSLF89_1457
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:psal03000]
    PSLF89_1457
Enzymes [BR:psal01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     PSLF89_1457
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     PSLF89_1457
Transcription factors [BR:psal03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    PSLF89_1457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Motif
Other DBs
NCBI-ProteinID: AKP73364
Position
complement(931014..934850)
Genome map
AA seq 1278 aa AA seqDB search
MLYANQHPKYQPSTLRVAITNAWCMDEQQAINALLYTSLMTEHQVRYTQQQAHQLIEKVR
SARLSQGGIDAFMQEYSLSSQEGIALMCLAEALLRIPDTTTSDKLIKDKLSDMNWSAHQG
QSDSLFVNSATWGLILTGQILSAESTRASTISRTLKKLSGRIGEPMIRQAIRYAMKLLGE
QFVTGQTIEAALKCAKKKENIGYRYSYDMLGEAAKTDADALFYLSEYKKAIEAIGTQSKD
LDIISGPGISIKLSALHARYEVAQYGRVMGELYPRLYELALLAKKYNLGLNIDAEEANRL
ELSLDLIEKLCEEPSLAGWNGIGVVIQAYQKRCPYVIDWLIDTAKRTQHRLMIRLVKGAY
WDSEIKLAQELGLDGYPVYTRKVYTDLSYLYCAQKLLDAPEQVYPQFATHNAYTLSAILE
LAGQYRDFEFQCLHGMGETLYDQVVDKNNLNIPCRIYAPVGTYKNLLAYLVRRLLENGAN
SSFVNQILDKNIPISRLIADPIQIVKSLAGKPHAHLPLPRNLYGNQRLNSKSFELNSEKD
LDQLNCAMAQFSQKLYHAKPTTAVSTDHLNSDNDQDPPPTAIKNPANHDEIIGHVSEADE
KHIEVALTVATAAFPAWQHTTCDQRATLLEKAADLFEEHMPELMQLAIREAGKTLANAIA
EIREAIDFCRYYAKQAREEFTVESGLTGRGPIACISPWNFPLAIFTGEVAAALAAGNTVL
AKPAEQTPLIAARAVELMHQAGISPDVLQLLPGQGEIVGAALVQDQRIKGVIFTGSTEVA
HSINRTLAQRDEVIPLIAETGGQNAMIVDSSALAEQVITDVITSGFDSAGQRCSALRVLF
LQEDIADHMISMLKGAMAELTIGNPAQLNVDVGPVIDTEAQTRLNQHIEKTKTQAKLLFQ
CELPENNGTFVAPTAFELNNLNDLKQEVFGPIIHIIRFKAGELDQVIEQINATGFGLTLG
VHSRISKTINEVIAKAKVGNLYINRNQVGAVVGVQPFGGEGLSGTGPKAGGPLYMHQLVS
SQYSQDQQHNESHNTEHTHSSAPAPTTAVTIDAIKQAISQQTIWQEGNAQRSALLEIALN
KARDRKLTPNLDHHQLDLLITQAKALASKIQQATLLPSPTGENDTLSNHPRGTLLYLLDQ
ATTVAAGLNSISTTLASGNSLVVVNIHPTITHINIQAIINCFYDAGVPHAALSFFATHPE
EINPVIANHQIAIAGLIYSGANPTAYNKQLSLRTGAILPFIHITKHSVPLHRLVHERTIT
INTTAAGGNASLMTMQED
NT seq 3837 nt NT seq  +upstreamnt  +downstreamnt
atgctatacgctaaccaacatcccaaataccagccatcaaccttacgcgtcgccattacc
aatgcctggtgcatggatgagcagcaagcaatcaacgctttgctttacacgtcattaatg
actgagcatcaagtacgctatacgcagcaacaagctcatcaactgatagaaaaagtccgc
tctgctcgtctttctcaaggtggcattgatgcatttatgcaagaatacagcttatccagc
caagaagggattgcactgatgtgcctggctgaagccttactacgtattccagataccacc
acttcagataaattaattaaagataagctcagcgatatgaactggtctgcgcatcaaggc
cagagtgactcattattcgtgaattcagccacctggggcttaatcctcaccggccagatc
ctcagtgccgaatccacccgcgccagtaccatttcgcgtacgcttaaaaaactcagcggg
cgcatcggtgagccaatgattcgtcaagcgatccgctatgcaatgaaattactcggtgag
caatttgtcaccggccaaaccatcgaagcggcgttaaaatgtgcaaaaaaaaaggaaaat
attggctaccgttactcatatgatatgctcggcgaagcggcaaaaaccgatgcagatgcg
ctgttttacttaagtgaatataaaaaagccattgaagccattggcacacagagtaaagac
cttgatattatctcagggcccggtatttccattaagctctcagccttgcacgcacgttat
gaagtcgcccaatacggtcgagtgatgggtgagctttacccgcgcctctatgaactggcc
ttgctcgcaaaaaaatacaatttaggcttgaatattgatgccgaagaggcgaatcgtctt
gagctctccctcgatttaatcgagaaactttgtgaagaaccaagcctggccggctggaat
ggcatcggtgtcgtcattcaagcctaccaaaagcgctgtccttacgtcatcgactggctg
atcgacacggctaaacgtacccaacaccgcttgatgatccgtttagttaaaggtgcctat
tgggattctgaaatcaagctcgcccaagagttaggccttgatggctatcctgtttacact
cgtaaagtctataccgatttatcttatctgtattgtgcgcaaaaactcctggatgcccct
gagcaagtttatccacagtttgccacgcataatgcgtatactctatcagccattttagag
ttggctggacaatatcgcgactttgaattccagtgcctacacggcatgggcgaaactctg
tatgatcaagtggtcgacaaaaataatctaaatattccttgccgcatttatgctccagtc
ggcacgtataaaaaccttctcgcctacctggtccgccgcctacttgaaaatggtgccaac
tcatctttcgttaatcaaattctcgataaaaatatcccgattagccgcctgattgcagac
ccgatacaaatcgtcaagtccctcgctggtaaaccccacgctcacctacccttaccgcgc
aatctctatggcaatcaacgcttaaactccaaatcatttgagttaaacagcgaaaaagat
ctcgatcaactcaattgtgctatggctcaatttagtcagaaactctatcatgctaagccg
acaactgcagtcagtacagatcatttaaatagtgacaatgatcaagaccctcctcccact
gccattaaaaacccagcgaatcatgatgaaattattggccatgtcagcgaagccgatgaa
aaacacattgaagtagcattaacagtagccacagcagctttcccagcatggcagcacaca
acctgcgatcaacgcgccacactcttagagaaggcagcagaccttttcgaagaacacatg
ccagagctcatgcagttggcgattcgtgaagcgggtaaaaccctcgccaacgctattgca
gaaattcgcgaagcgattgatttttgccgctactatgccaaacaagcgcgtgaagagttc
acagtcgaatctggcttaaccggtcgtgggcctattgcctgcattagcccatggaacttt
cctctggccattttcaccggtgaagtcgccgccgcccttgccgccggaaatacagtactc
gcgaaacccgccgaacaaacgccactgattgccgcacgtgcggttgaactcatgcaccaa
gccggtattagcccagacgtattacagttactgccaggccaaggagaaattgtgggtgcc
gctctggtacaagatcagcgcatcaaaggcgtgatttttaccggctctactgaggtagcg
catagtatcaaccgcactctggcacagcgagacgaggtcattccactgattgctgaaacc
ggcggtcaaaacgccatgatcgtcgactcttccgcattagcagagcaggtcatcactgat
gtcatcacctcaggctttgatagtgccggccaacgttgctcagccctacgtgtattgttc
ttacaagaagatattgctgatcatatgatcagcatgctcaaaggcgcgatggctgagctg
acgatcggcaacccagcacagctgaatgtcgatgtcggcccagtgattgatacagaagca
caaacacgcttaaaccaacatatcgagaaaaccaaaacacaagctaaactactatttcag
tgtgagctgcctgaaaataacggcacctttgtcgctcccaccgcctttgaactcaataat
cttaacgatctcaaacaagaagtcttcggcccaatcattcatattattcgctttaaagcc
ggtgagttggaccaggtcatagagcaaattaatgctacggggtttggtttaacgctagga
gtacatagccgcatctctaaaacaattaatgaggtcatcgctaaagccaaagtcggtaat
ttatatattaatcgcaatcaagtcggcgccgtagtcggtgtccaaccttttggtggtgaa
ggcttatccggcacagggcctaaagctggagggcccctgtatatgcatcaactcgtcagc
tctcaatacagtcaagatcaacaacacaatgagagtcataatactgaacatactcacagc
tcagcccctgcaccaaccactgcagtcactattgatgcaattaaacaggcgattagtcag
caaacaatctggcaagaaggcaatgcacaacgcagcgcgttacttgaaattgctctaaat
aaagcccgtgatcgtaaactaacgccaaacctcgatcaccatcaactggacttactcatt
acccaagccaaagccttagcttctaagattcagcaagccacgttactgccaagccctacg
ggtgaaaatgataccttatccaaccatccgcgcggaacactgctttacttacttgaccaa
gcaacaacagtcgccgcaggtcttaatagtatcagtacaacacttgccagtggaaatagc
cttgtcgtcgttaatattcacccgaccatcactcatattaatattcaagcaataattaat
tgcttttacgacgctggagtgcctcatgctgcattatccttttttgccacccatcctgag
gaaataaatccagtcattgcaaatcaccagatcgctatcgccggcttaatttattctgga
gctaatccaacagcctataataaacaattgagcttacgtacaggtgcaattttgcctttt
attcatataaccaaacactctgtacctttgcaccgattggttcatgagcgcacaattacc
atcaatactaccgccgcaggaggcaatgcatcattgatgacgatgcaagaagattaa

DBGET integrated database retrieval system